[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for dred0:ABO51003.1


[Show Plain Result]

## Summary of Sequence Search
   1::247
  72::247  1.9e-55 48.0% 0041613 00416131 1/1   /beta knot                              
  71::247  5.1e-53 46.3% 0044758 00447581 1/1   /beta knot                              
  72::245  2.6e-48 47.5% 0050073 00500731 1/1   /beta knot                              
   1::71   1.2e-18 42.3% 0041612 00416121 1/1   omain-like                              
   2::70   9.5e-18 40.6% 0044757 00447571 1/1   omain-like                              
 144::244  8.2e-07 34.7% 0039893 00398931 1/1   /beta knot                              
   1::247


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPRFFVQPEQINSDTAVINGPDVKHISRVLRMETGNNLTLLDGRGNVYLAQILEINKQEVHCRILEQQEA
00416131   1/1  ----------------------------------------------------------------------
00447581   1/1  ----------------------------------------------------------------------
00500731   1/1  ----------------------------------------------------------------------
00416121   1/1  rmprffvdeelllgqtvtldgdeahHlvrVlRlkvgdevllfdgdggeylaeiteiskksvlveilelll
00447571   1/1  -qrlfveeellldlsggvvvldgdeahHlvrVlRlkvgdevilfdgdggeylaeiteigkksvtveilev
00398931   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           TSEPTVKVTLVQGLPKGDKMETIIQKCTELGVSSIIPLAAARSIVKLDAKKAAERVQRWQRVAVEAAKQC
00416131   1/1  -pelplrltlalalpkgdrlelilqkatelGvsaivplitersvvklkgeklelklerlekiaieAaeQs
00447581   1/1  elelplrltlalalpkgdrlelilqkatelGvsaivplitersvvkldgeklekklerlekiaieAaeQs
00500731   1/1  -pelpldltlalalpkgdrlelilekatelGvdrivplltersvvkldge...lklerwqkiaieAaeQs
00416121   1/1  v---------------------------------------------------------------------
00447571   1/1  ----------------------------------------------------------------------
00398931   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           RRSGIPEVYMLSSWDEILQQIPPDALVLMPWEGERTKSLREVLQTRPMAPGQVYIFIGPEGGFEEEEVER
00416131   1/1  grlllPevllplslkellell.dldlvlvlheeaallllllll....laagkvllliGPEGGfseeEiel
00447581   1/1  grlllPevllplslkellellldadlllvldegaalllllllllsllsllsaagsillliGPEGGfseeE
00500731   1/1  grlllPevllplslkell....eldlllvlheeaal.....lllllllslgsvllliGPEGGfseeEiel
00416121   1/1  ----------------------------------------------------------------------
00447571   1/1  ----------------------------------------------------------------------
00398931   1/1  ---lsrktvsvaiPtsildnakslelktylagqiaRaaaiFgvdeiviydddledeakllaslleyletP


                         -         -         -         +         -         -         -:280
query           VKEKGFYPVTLGSRILRTETAGPAALTMVLYQFGELG---------------------------------
00416131   1/1  llelgfvpvsLgpriLRteTAalaalalllallgdlg---------------------------------
00447581   1/1  iellleagfvpvsLgpriLRteTAalaalalllallg---------------------------------
00500731   1/1  lleagflpvsLGpriLRteTAalaalallllllgd-----------------------------------
00416121   1/1  ----------------------------------------------------------------------
00447571   1/1  ----------------------------------------------------------------------
00398931   1/1  qylrkllfpisnelkfagllppLdilphlvidll------------------------------------