[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for elen0:ACV54068.1


[Show Plain Result]

## Summary of Sequence Search
   1::158
   1::81   PF02082 0.0% 39.5061728395062  Transcriptional regulator 
  20::64   PF03444 0.0% 26.6666666666667  Domain of unknown function 
   1::158


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQLKASTDYGMRAILYLAAQGTTCSSKDIAEDMSIPRDYLIQLAQLLRNAGIIEARPGKHGGYRLAKDPA
PF02082         MklsskteyalhallyLakeeeeepvsseeiaerqnispvylekilakLrkaglvksvrGkgGGyrLarp
PF03444         -------------------kkravKgeeiAevlkrneGtvRNqlqsLkalgLvegvpGPkGGYk------


                         -         -         *         -         -         -         -:140
query           DTNVLEIMEALDDDAKQSTRAKRDARKGGAMVQEIKQVYDLIEESMDAYLSSLTVQMLLDCARNGDNSRT
PF02082         peeItlldvvr-----------------------------------------------------------
PF03444         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           FLAERLQEESRRLLDAVK----------------------------------------------------
PF02082         ----------------------------------------------------------------------
PF03444         ----------------------------------------------------------------------