[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for elen0:ACV54171.1


[Show Plain Result]

## Summary of Sequence Search
   1::389
  26::300  PF02626 0.0% 44.9814126394052  Allophanate hydrolase subunit 2 
   1::389


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGLVVKKPGVITTIQDVGRFGYQGSGFSTNGVMDHRAFAIANLLVENDPGAPVLEFALAGPTVRFTTNTC
PF02626         -------------------------GvpasGamDrlalrlAnrlvgnpenaaalEitlgglelefeedtv


                         -         -         *         -         -         -         -:140
query           FAITGGDFAPTLDGEPVPMYAAVMVRRGSILRFKASRTGCYGYLAIAGNSVRVPEVMGSRSTNLKCEFGG
PF02626         ialtGadleatldgepvplwqsvavkagdvLklgaakaGlraYLavaGgi.dvpevlgSrStdlraglGg


                         +         -         -         -         -         *         -:210
query           WKGRTLIVGDYLPFSTKSVDFLPNLGSHRIDGDNEFYGFDRDEITVRVVPGPQQDMFTDKGLATFYGQAY
PF02626         legralkagdvLplgeasaaaaaea.....svpekaapeyskelelrvvpGpqadlfteealerflesef


                         -         -         -         +         -         -         -:280
query           TTTTKCDRMGYRLDGPEIETKHGSDIISDGVAFGAVQVPSHGRPIIMLADRQTTGGYAKIGTIASVDIPK
PF02626         kvspnsdRmGvrLeGpkpleraepseilsegvvlGaiqvppdGqpivLlaDrqttGGYpkiatVisadld


                         -         *         -         -         -         -         +:350
query           LVQRPPGGKIRFESIGVQEAQALLREEAHLFEMLALKVRRPSADGISPRRTARRLTPILEEQARKSQADM
PF02626         klaQlrpgdkirFkavslee--------------------------------------------------


                         -         -         -         -         *         -         -:420
query           LWIDRADRSQRVGNRNALGTVPPKKQPPDATDTTERATT-------------------------------
PF02626         ----------------------------------------------------------------------