[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for elen0:ACV54358.1


[Show Plain Result]

## Summary of Sequence Search
   1::589
  88::554  PF00890 0.0% 25  FAD binding domain 
  80::163  PF01946 0.0% 25  Thi4 family 
  88::297  PF01266 0.0% 23.9583333333333  FAD dependent oxidoreductase 
  88::132  PF01134 0.0% 35.5555555555556  Glucose inhibited division protein A 
 282::305  PF01134 0.0% 29.1666666666667  Glucose inhibited division protein A 
  88::187  PF07992 0.0% 18.9873417721519  Pyridine nucleotide-disulphide oxidoreductase 
  89::149  PF00070 0.0% 23.728813559322  Pyridine nucleotide-disulphide oxidoreductase 
  88::120  PF03486 0.0% 42.4242424242424  HI0933-like protein 
   1::589


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MITKGTAFDRRSFLKGAMLAGAGTAAFGLAGCAANGGGASGGASSNASASSGTAGQLSAEAISKGTWAFE
PF00890         ----------------------------------------------------------------------
PF01946         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF01134         ----------------------------------------------------------------------
PF01134         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           IAPEPVADSEIAQAYEADIIVVGAGVSGLACAASATEEGADVILFAASSQPVARGGSNHGIGTKFHERLG
PF00890         -----------------DvvViGsGlAGlaAAleaaeaglkvavvekeqetggatawsqGgidavlspeq
PF01946         ---------dllkyaesDvvivGaGssGltaayylakkdlkvailerk...lsiGGGawlGGqlfsk.vv
PF01266         -----------------dvviiGgGivGlstAyeLarrglkVtllekgdiasgaSgrngglihagllker
PF01134         -----------------dviViGgGhAGceAAlaaarlGakvlLithkldtiaelsCnpsig--------
PF01134         -----------------dviViGgGhAGceAAlaaarlGakvlLithkldtiaelsCnpsig--------
PF07992         -----------------dvviIGgGpaGlaaakrlarlglkvalierepggtclnrgcipkkllleaaee
PF00070         ------------------vvvvGgGyiGlElAaalaklgkkVtvierrdrll..raldeeiakilqkkle
PF03486         -----------------dviviGgGaAGlmaAisaakrgakVllldkakk--------------------


                         +         -         -         -         -         *         -:210
query           ITDYTKDTIDGFIRQELARNGYRVDQKKWYKWINNSASTMNWLIDLMEAKGYTTTMEIGYTDTEGVFTAH
PF00890         kkagikdspdlhrtdtlkal........deladqplveafveaapeavdeleel....gvpfsrtedgpv
PF01946         vrkeakelLdelgiryedegdyv-----------------------------------------------
PF01266         dprllrlalesldllrel....aaetgidvdfrrtgvldlasdeeeleelerlaerarangl....dvel
PF01134         ----------------------------------------------------------------------
PF01134         ----------------------------------------------------------------------
PF07992         e.....................eldlkeleerkdegievllntgvtd-----------------------
PF00070         kngievlln-------------------------------------------------------------
PF03486         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           PGSHNWVEQADGKESGAATGENLVIAMYEEKIKEQGGQIHYSTIGQYLIREDNNTGRVSAIVAKDPDGNY
PF00890         dlrelGglsat....rtlhdaadarretlvtghallarllesareagkvdfqerhradeLivedg...rv
PF01946         ----------------------------------------------------------------------
PF01266         lsaeevrerepllspdlkgglfypddgqvdpaklvkalar.aaeelGveiiegtkVtglereggr...vs
PF01134         ----------------------------------------------------------------------
PF01134         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           VKYVGRKAIVLATGDFSANQDMMAKYCSWVAPLLQYNEVDYDAMFQFGGLGPGDGQKMGLWVGAAWQQTL
PF00890         tGvvvenprsgrevrirakaavvlatgGfgrd......rrallkellg..aaaeaettnap.antGdgia
PF01946         ----------------------------------------------------------------------
PF01266         gvrt..edgsira....-----------------------------------------------------
PF01134         -etikakavviatGtflkgkihige---------------------------------------------
PF01134         -etikakavviatGtflkgkihige---------------------------------------------
PF07992         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           PNAPMIDAVGPMPYRQSIADFSGLLLNKKGERYSNEDVIFSYGTYAMMMQPDMTRYGIWDTAYANWFDTW
PF00890         lalragaalnddrmeevqfhPtslvpirdgsgiLitealrgeGgilvdkdGrrFm...............
PF01946         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF01134         ----------------------------------------------------------------------
PF01134         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           ETFGTTIVENEGKNATTPEGYLASWDSNVEKGTFVKGDTIEEVIAQLDGLDPENAKKSVERYNELCEAKY
PF00890         ...............nelasrdvvsrailekeiaeggseanvyldadh......................
PF01946         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF01134         ----------------------------------------------------------------------
PF01134         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           DDDFHKSATLLAPIKEGPFYGCKLEMSPANFLCVTGGLRTNENMQVCDEQNEPIEGLYNLGIMVGDSYAN
PF00890         gldaealeatleaineeaengldkdfgrgidpadrpipgpfyavkvvpaq...hytmgGvrtde------
PF01946         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF01134         ----------------------------------------------------------------------
PF01134         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           CYNFAICGHNLGMNCNTFAYMLGKDLAEA-----------------------------------------
PF00890         ----------------------------------------------------------------------
PF01946         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF01134         ----------------------------------------------------------------------
PF01134         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------