[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for elen0:ACV54398.1


[Show Plain Result]

## Summary of Sequence Search
   1::447
  92::364  PF00501 0.0% 22.3529411764706  AMP-binding enzyme 
   1::447


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAKDIPYDQKYYDPEIECMPRPELEALQLERLKDMVAYAYDNTVYYKRAFDEAGVKPGDIESLDDIAKFP
PF00501         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           FCDKKTERETQHVGSFFGEMCSVPEEEVIFMATSSGSTGVPTVSPFTQEDFDLWQDTEARLFWQAGMRPN
PF00501         ---------------------plkpddlayiiyTSGtTGkPKgVmlthrnlla...lvagiakrvglkpd


                         +         -         -         -         -         *         -:210
query           DRYVHGLNFALYVGGPDVIGAQRLGALAIWVGAVPSDRLLFVLKQYQPTIIWTSPSYAWHLGEIAKEKGF
PF00501         drvlsllplafdgsvleilgplllGatlvlvspedlkdpalllddiekykvtvlalvptllelllkapek


                         -         -         -         +         -         -         -:280
query           DPKEDFNIHTIIVAGEAGGSIKSTREAIENLWGAKVVDFYGLSDIYGACAAACEAHDGLHIVEDQILVET
PF00501         ...kkldlsslrlilsggeplspellrrlreafg...gipivngYGltEttvivtvslpgdeetkpgsiG


                         -         *         -         -         -         -         +:350
query           VDPTTGEVLAPGETGELVYTTLCKKARPMIRFRTGDIGYVSTDTCECGRTLARIHVTGRKDEMFIVGAVN
PF00501         rplpgveikivdeeg.kevppgevGEllirgpsvakGYlkdpeltaeafvedgwklyrTGDlgrided..


                         -         -         -         -         *         -         -:420
query           VFPSDIEYVVRGLDGLTGEYSIRVYEKNFTCKYEVSVERSLGSDEPYDEVASRTEAALKAHTGVRPAKVI
PF00501         ......GyleiiGR--------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           VYDAGKLGTSSEHKASRFIDERGCVTR-------------------------------------------
PF00501         ----------------------------------------------------------------------