[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for elen0:ACV54452.1


[Show Plain Result]

## Summary of Sequence Search
   1::292
  10::282  PF04976 0.0% 33.0855018587361  DMSO reductase anchor subunit (DmsC) 
   1::292


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MISGFDTALGEITLVLFTTLAPSGVVAFICMGLPVLGRGASVALRQRLNVFLGLPLVVAMVGLVASATHL
PF04976         ---------pelslvfFtvlaqavvGafillalllllgknqalprevvlvgmfvlliLlgiGliasilHL


                         -         -         *         -         -         -         -:140
query           GNPANALYVFLGVGRSPLSTEVFCAVVFLALAGLYWLYNFVEHPKPQLQRAWLVLAMLAGAVFVAAVGCA
PF04976         GsplRAfnalnrvgsSwLSrEivagaiffalagliwLvavlkklskaleklllivtailgiifvymmamv


                         +         -         -         -         -         *         -:210
query           YAADTIVSWHTVYVPLNLMLNALVGGPILAIAGLRAAGYEPVEGRMGRVLTMVAAAALAVNVVTFGVQGA
PF04976         YasiktvptWhsgyTllaflltvlltGsvllyallqaakva..tvav.lalpllavlaltlaaivtvlqg


                         -         -         -         +         -         -         -:280
query           DLASIENSYLTAAELVPSYGLMVCAFGVLGMAGIGLDAVELWPRRVRLSVGRAAGAAVLVLAGIFVMRFA
PF04976         aslrsiessvqeanalvpeyatlrvlrlvllfvllllllaalfalkvpnvall.vlavllilagelieRt


                         -         *         -         -         -         -         +:350
query           FYMMHMTVGLGV----------------------------------------------------------
PF04976         lf--------------------------------------------------------------------