[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for elen0:ACV54505.1


[Show Plain Result]

## Summary of Sequence Search
   1::520
 463::516  PF00196 0.0% 38.8888888888889  Bacterial regulatory proteins, luxR family 
   1::520


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPALRRSIQSSARELARVIARDGAASFVLAVVGLACCFVFCSMGSSVETVAMRSSELFAPSGQADALPTF
PF00196         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           AVTAGSLAAYALFGWAPLRAVDRVRGSMPVYAVCCVALAAVYAVTSLPVLSDASGARALLLVLRGFLGVT
PF00196         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           TLVSWFALLGDRPRLFQVSAIAVAFAATALADLAFLALQAAVGFALLVALPLLSLGAYRVVARKRSGAGA
PF00196         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           AAAAPAGAASAAAVGDAEPSRAASGGVARVLGSPILFCLLAGAVLGCIQGVGADLVLAHEQLAGGYVANN
PF00196         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LLVAAALAIAAALVGGGAAFAHDGDDARLLAYARLTVIVALVLALCLANVLMMSGTFVSLTAAKLIGALL
PF00196         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           LAYAWFAACARPGARAVRALTRMLVCWQVAAALLQAAVMAMAGEGPVQVVNVIVVILLGAVLVMQLFPLF
PF00196         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           LSSRPATFPTGPSNGQTRSQALSISADEADLALVERFADEYGLTPRERELLGFFAQGYSVAYASEQLVLS
PF00196         ------------------------------------------LskRErevLrllaaGksnkeIAdeLgiS


                         *         -         -         -         -         +         -:560
query           PYTVRTHLRNIYVKTDTHSRDDLLALLKTY----------------------------------------
PF00196         ekTVkvhrsnimrKLnvksrvelirl--------------------------------------------