[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for elen0:ACV54563.1


[Show Plain Result]

## Summary of Sequence Search
   1::474
  43::68   PF00196 0.0% 26.9230769230769  Bacterial regulatory proteins, luxR family 
 414::467  PF00196 0.0% 44.4444444444444  Bacterial regulatory proteins, luxR family 
   1::474


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQQATGGEKSRVVAKPARSDIQRGGIALDAFASALFWGYVAIMFGSSEIKIAESIGLAPENVALICGNVV
PF00196         ------------------------------------------aaGksnkeIAdeLgiSekTVkvhrsn--
PF00196         ------------------------------------------aaGksnkeIAdeLgiSekTVkvhrsn--


                         -         -         *         -         -         -         -:140
query           ALVAVGLLGPRAHGSHLFVLGLAGSGTACILQTVSLLSPEMVPVAWSRLFACGASAILVLAWCEHISSET
PF00196         ----------------------------------------------------------------------
PF00196         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           SQERPLFLALCSLLTIVIVLVSIQLGARSAILFGGVLPVVSAALGAYRTRASARTAPSVTIQPPFPLYLI
PF00196         ----------------------------------------------------------------------
PF00196         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           VILFVFGFMISFFSLLNRRTGTVENFMIPAGIDPFLAGWTVLVLVIAGCVWMLLPQRHASLVTTVLIPLA
PF00196         ----------------------------------------------------------------------
PF00196         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           SLGLLLPPFLRYGLQETLPAVVAFIVICEAIICSVGPSNAKKYFHIGSFTFVFWTRSFGLIGMIVGYAAA
PF00196         ----------------------------------------------------------------------
PF00196         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           ILLFDIMKIAIDFDILLIMFAAYAILCLTVAVMLGRIGLKAPAERERESTPAAAAHALAERYGLTAREAE
PF00196         ---------------------------------------------------------------LskREre
PF00196         ---------------------------------------------------------------LskREre


                         -         -         +         -         -         -         -:490
query           VLELVAQGRNMTYVQKALCISPGTSSTHINHIHQKLDVHSREELIDLVQEELAR----------------
PF00196         vLrllaaGksnkeIAdeLgiSekTVkvhrsnimrKLnvksrvelirl-----------------------
PF00196         vLrllaaGksnkeIAdeLgiSekTVkvhrsnimrKLnvksrvelirl-----------------------