[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for elen0:ACV54634.1


[Show Plain Result]

## Summary of Sequence Search
   1::367
   7::359  PF06032 0.0% 44.9856733524355  Protein of unknown function (DUF917) 
   1::367


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRKIGIQEIEDIALGATLLGAGGGGDPYIGKLTAIGAVKECGEVELIGIDEVPDGAFIMPAASMGAPTIL
PF06032         ------edleaiatGaavLGtGGGGdpysgkllleealkeggkvevvsvdeladddlvvtvammGaPavs


                         -         -         *         -         -         -         -:140
query           AEKGVGANEFAKLFDMVSRYYGKPIYATMPIEAGGVNSMLPIAAAARLGIPMVDVDGMGRAFPELQMVTF
PF06032         seklpegdealkavealeellgrkldaiislEiGglnslvallvaaklglpvvDaDgmGRAfPelqmttf


                         +         -         -         -         -         *         -:210
query           TIGGASATPMAFIDEKGNSGILDTITNKWTEDIARAATMTMGGTLTVALFCMDVDTCKQYGVHGIVTRSE
PF06032         avaglsatpavladekgnsvilteaaddarverllRaalvemGgsaalaaypmsgaelkeaailgtlsla


                         -         -         -         +         -         -         -:280
query           ELGRAIRTAKDEAAAAGLTPEEFFLKFTGGHKLFKGKISDVLRETRGAFNFGRVVLEGIGEDRGSQAFVD
PF06032         leiGraireareksa....dviealldalggkllfkGkivdveretkgGfdvGkvtiegleedkgrtlki


                         -         *         -         -         -         -         +:350
query           FQNENLSCVVDGQIKATVPDLICLVDPDTFTPVPTDALKYGKRVLAVGLECFHLWRTQAGLDLVGPRYFG
PF06032         pfqNEnllaeknkgevlatvPDlItvldeetgepvtteelryGlkVaVialpaspkwrtekglevvgpaa


                         -         -         -         -         *         -         -:420
query           IDTDYIPVEERSARKEA-----------------------------------------------------
PF06032         fgydieykp-------------------------------------------------------------