[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for elen0:ACV54696.1


[Show Plain Result]

## Summary of Sequence Search
   1::163
  25::141  PF01503 0.0% 25.3164556962025  Phosphoribosyl-ATP pyrophosphohydrolase 
   1::163


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSQKTYIPSGEMPPSSQIGATFEALAATIAARREAGEESYTYRLLTGSLDGVLKKVMEEAGETALAAKDV
PF01503         ------------------------fhrtfdlrkeetpeasdpelaal....raallvEElvElleAasqg


                         -         -         *         -         -         -         -:140
query           ESWACSSLAASIAASGAVDETDELAVDLPPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNN
PF01503         ..................................dlveladalaDllYvlygllvllGldldavfeeVhr


                         +         -         -         -         -         *         -:210
query           RMTDAERPEGGVRLHEDHVKRGK-----------------------------------------------
PF01503         a---------------------------------------------------------------------