[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for elen0:ACV54852.1


[Show Plain Result]

## Summary of Sequence Search
   1::126
  27::111  PF02643 0.0% 32.0512820512821  Uncharacterized ACR, COG1430 
   1::126


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNDRYLDEAVAVTASGKRVPILTHTCRGFLERFCGLMLKREVPEACGLYFPGCRSIHTCMMRVPIDVVWV
PF02643         --------------------------dtpeerarGLmfreslpedegmlfvfeeesvhtfwMkntlipLd


                         -         -         *         -         -         -         -:140
query           REGEPGELDAVSLDVALKPWRFFAAPRGATGCVEFRAGSFDPADRPAEIARPKKRK--------------
PF02643         iiFldadgr.....vvaieeavppcr..eepipskepakav-----------------------------