[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for elen0:ACV54955.1


[Show Plain Result]

## Summary of Sequence Search
   1::381
 128::374  PF01702 0.0% 52.3206751054852  Queuine tRNA-ribosyltransferase 
   1::381


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MALFDCELQATSGHARALSYETAHGSFQTPMFMPVGTSASVKGVTVGQLNDLNAQVVLANTYHLSLRPGA
PF01702         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           DVVAEAGGVHRFMNYDGPMLTDSGGFQVFSLADTLKLDDEGLTFRSIYDGTKVRWTPESNMEIQEQLGAD
PF01702         ---------------------------------------------------------eksieiqealgsD


                         +         -         -         -         -         *         -:210
query           IAMQLDQCTPYPAEKAFVAKAVDLSANWARRCLAAHQRPDQTLFGIVQGGMELDLRLESIRRLREIEDES
PF01702         iimvldectpykatreraeksvertlrwaercleahkekkkqalfgivqGglyedlreesaeelse....


                         -         -         -         +         -         -         -:280
query           LARGGRRFGGFGIGGYSVGEDHEVMFETLGPVARACPEDRPRYLMGVGNPTTLVRAVREGVDMFDCVLPT
PF01702         .....d.kfdgyaigGlsvgeekeemaelvkivtaelpedkprylmgvgtpedileavalGvDlfdcvlp


                         -         *         -         -         -         -         +:350
query           RTARMGTAFSSTGRMNMRNAKFTRDFGPLDPACTCPTCRNHSRAYIRHLVKQNEMLGGILLSVHNLHYLI
PF01702         trlArngtaltfegklnlknarykedfrpldeecdCytcknysraylhhLlkakemlastlltiHNlyyy


                         -         -         -         -         *         -         -:420
query           DLMRRAREAVLAGAYEEFYEAWMASPAAKDY---------------------------------------
PF01702         lklmqeiReaieegtleelveefl----------------------------------------------