[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for elen0:ACV54981.1


[Show Plain Result]

## Summary of Sequence Search
   1::235
   4::113  PF00072 0.0% 35.4545454545455  Response regulator receiver domain 
 152::228  PF00486 0.0% 48.0519480519481  Transcriptional regulatory protein, C terminal 
   1::235


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKILLIDDENSIARLVGSMAGDAGYAFAYAEDGAEGLVVAEREAPDLVIMDVMMPRMDGFTTCRLMRER
PF00072         ---vlivdDeplvrellrqalekegyeevaeaddgeealellkekdpDlillDiempgmdGlellkeire
PF00486         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           GITCPVIFLSAKGDIVDKGVGFQAGGDDYMVKPFDPRELLMHIEAHLRRASMAAAPVAPRGDILHAGRFV
PF00072         eepklpiivvtahgeeedalealkaGakdflsKpfdpeelvka---------------------------
PF00486         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LDRGQFRVTKDGERLSLTPKEFKIFFALASSPGLVLSKEQLVEAAWGKEFVGETSSITVFIKKLREKVED
PF00072         ----------------------------------------------------------------------
PF00486         -----------geevpltpkefklLalLaenagrvvsreeLleevwgeefevddntvdvhisrLRkkled


                         -         -         -         +         -         -         -:280
query           DPSDPRVIQTVWGIGYRFEPEGREG---------------------------------------------
PF00072         ----------------------------------------------------------------------
PF00486         apkepkliktvrgvGYrl----------------------------------------------------