[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for elen0:ACV55062.1


[Show Plain Result]

## Summary of Sequence Search
   1::359
 114::249  PF00174 0.0% 29.4117647058824  Oxidoreductase molybdopterin binding domain 
 267::350  PF03404 0.0% 25  Mo-co oxidoreductase dimerisation domain 
   1::359


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAYNPKKIAGGVAGGALLMFGAVGGIGATAGLPQTADADPIATTHAVGDNVVTAQWFNEDDVSYVSVANA
PF00174         ----------------------------------------------------------------------
PF03404         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           QGAFTFNQEGVTPNDELFNVFGTALTSMCSKPATELVDVEGGVANFYVNVGGNIKKNFTIDVRDLAEDAN
PF00174         -------------------------------------------ekwklevdGlverplslsledLkklpa
PF03404         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           QETMMACSCATGSPFGQAAVMGVPLSAVVEMADLEDGVNTITAYGADGFGQPLPLRYALEKNALLAYQVN
PF00174         eevtatlqCvgnrreglqwsagaignakWtGvpLadvLkeaglkpearhvvfegadeeeeeksgyaesip
PF03404         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GQELEAATGSSLQLWMPETVARYFTRDIVNIELTQEDAEPDVQQVDPCYRNKINIMNYSDDCVFKAGDEI
PF00174         lekaldedvlLAyemngepLppdhGaPlRlvvpglygak-------------------------------
PF03404         --------------------------------------------------------speheekvklgeet


                         -         *         -         -         -         -         +:350
query           TFEGVADDLGSPIAAIEFSFDNGRTWTSCDTDGATADKWVNWQFTTSFEEKGDYRMTVRAKTADGMVSPL
PF00174         ----------------------------------------------------------------------
PF03404         ytvkGyAysgggrritrvevslDkGksWklaeleyeedkyregessfcwcfwsldvdvselkkekeilvr


                         -         -         -         -         *         -         -:420
query           AATLLFEVA-------------------------------------------------------------
PF00174         ----------------------------------------------------------------------
PF03404         ----------------------------------------------------------------------