[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for elen0:ACV55075.1


[Show Plain Result]

## Summary of Sequence Search
   1::286
  57::286  PF00889 0.0% 46.1187214611872  Elongation factor TS 
   5::41   PF00627 0.0% 38.8888888888889  UBA/TS-N domain 
   1::286


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAAVTASMVKELREMTGAGMMECKKALVEADGNIDQAVDVLRTRGLAAVAKKAGRATNEGTVMAIVSDDA
PF00889         --------------------------------------------------------aaeGlvavkvdenk
PF00627         ----deeaiqqLreM.GfsreeakkALratnnnvErAveyL-----------------------------


                         -         -         *         -         -         -         -:140
query           TSGAVVELNCETDFVGMNDKFKAYAEKIAQAALASKPADLEALKAADAAGETVEAVVTDAIHTLGENIQL
PF00889         ..avlvevnsETDFVAknekFqelvkkvaeaalekkaadveellalkleektvedalkeaiakigEniel
PF00627         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           ARFAVVEGGAVSSYIHGGGKIGVLVQFDVEGIDPASDGFKQFGRDVAMQVAAAAPVAATRESVDPAIVEH
PF00889         rrfakleaedevvasYvHgngkigvlvalegesdea.....kelakdvAmhiaAmnpqylseedvdaevl
PF00627         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           EKAIYMAQAAESGKPEAIQEKMATGRLEKFFKESTLTEQPFVKNPDQSVSEYAAEVAKNLGGEIKIVDFK
PF00889         ekekeiaeekakeegkpeeiiekiveGrlekflkevcLleQefvkddkktVeqvlkeasae....ikvvk
PF00627         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           RFVLGE----------------------------------------------------------------
PF00889         fvrfev----------------------------------------------------------------
PF00627         ----------------------------------------------------------------------