[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for elen0:ACV55195.1


[Show Plain Result]

## Summary of Sequence Search
   1::461
  78::420  PF00291 0.0% 25.8064516129032  Pyridoxal-phosphate dependent enzyme 
   1::461


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTEQAPHRLYLREDQIPTQWYNLRADMPEKPEPIRLPNGQVAAPEDLAPVFCDELVRQELDDDTAYVDIP
PF00291         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           EPVLEMYRIYRPSPLCRAYNLEKALGTPAKIYYKFEGNNTSGSHKLNSAIAQAYYAKAQDLDGITTETGA
PF00291         -------lgvgpTPlvrl.psallsklgganvflKlEslnptgSfKdRgaanallraka.gqkgv.veas


                         +         -         -         -         -         *         -:210
query           GQWGTALAEASAHFGLNLDVFMVKCSYEQKPFRRNIMETFDAHVTPSPSDTTEIGRKMLAEHPDSSGSLG
PF00291         sGNhGaavAaaaallglkctivvpkgapp...ekiaqiralGaevilvvssveedyddaaelaekaleev


                         -         -         -         +         -         -         -:280
query           TAISEAVERALNIPGNKGRYTLGSVLNQVVLHQSVIGLESYAAFEELGEYPDVVIGCAGGGSNLGGLIAP
PF00291         apl........................adndpdviaGygtiglEileqlg....apdpdavvvpvggGgl


                         -         *         -         -         -         -         +:350
query           FMRDKIKGVRPDTRFVAVEPASCPSLTRGRYAYDFADTGRTCPLAKMYTLGNGFLPSPDHAGGLRYHGMS
PF00291         aagiakglke......lpkirvigvepegsdalarslrage...eslda..................ett


                         -         -         -         -         *         -         -:420
query           PIVSKLKHDGYLDAVAVKQTDVFAAAVEFARLETILPAPESAHAIFQAVEEAKRCAETGEEKTILFGLTG
PF00291         iaglscgt..pldgelafelidelvdevvtvsdeealeavrllarregivvepssaaalaallkaekegs


                         -         -         +         -         -         -         -:490
query           TGYFDMKAYDAYNRGEMSDHVPTDEELEAGFASIPHIEGVQ-----------------------------
PF00291         ----------------------------------------------------------------------