[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for elen0:ACV55248.1


[Show Plain Result]

## Summary of Sequence Search
   1::187
   1::150  PF03358 0.0% 36.6197183098592  NADPH-dependent FMN reductase 
   1::123  PF02525 0.0% 23.7704918032787  Flavodoxin-like fold 
   1::187


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKLLAIAGSLRENSYNRQLAEAAGALMREKHPEVGYGILRWEDVPFMNQDIEHPAPEAVMRVREAVREAD
PF03358         mkilvisGslrkgsntrklaewaaealaeagaevelidladlilplcdedlee.esddlqellekiaaad
PF02525         mkiLiinahprpeksfssalaqafvealeeagphevtvrdLyadflpvlttrdlalayeek.padveseq


                         -         -         *         -         -         -         -:140
query           GLWLFSPEYNHAIPGPLKNLLDWLSRPVSATEAQVLAEKPVALAGASIGMSGASHAQDQLVGMLSFLDAH
PF03358         gviivtPeYngsypgllKnalDrls.......kkelrgKpvalvavgggragglraeealrpvlaelgav
PF02525         iekllaadvivlqfPlwwfgvPailKgwiDrvftagfafyteeggegsgggLk-----------------


                         +         -         -         -         -         *         -:210
query           VMNKPRLCIPHIATQADEQGRLKLESSAPYLEAQADAFVRFVEREQG-----------------------
PF03358         vvprgvvavs------------------------------------------------------------
PF02525         ----------------------------------------------------------------------