[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for elen0:ACV55249.1


[Show Plain Result]

## Summary of Sequence Search
   1::166
  25::152  PF01750 0.0% 33.6  Hydrogenase maturation protease 
   1::166


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGAARRIAVFCVGNKLMLDDGVGPAVYEELLTRYDIPDNVELFDLGCLSLNMIERVREYDVIITVDAVDG
PF01750         ------------------------rvvekLkkryedeenvelidgGtggldlvelleeadkviivDavdf


                         -         -         *         -         -         -         -:140
query           TDADPGTVFRFEPDAMARHSGATASLHDLKLVDLFDAAALLGYEAEGLCLGMQVENPSPAVVTVGLTPKV
PF01750         .glepGtlkileveeipkklkakkmsaHqlplsevlklleekgeipkevillgvqpesled..vgleLse


                         +         -         -         -         -         *         -:210
query           DAALPLLVETVAGELARLGSPLRARA--------------------------------------------
PF01750         evkkaidkavel----------------------------------------------------------