[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for elen0:ACV55343.1


[Show Plain Result]

## Summary of Sequence Search
   1::71
  14::67   PF01381 0.0% 25.9259259259259  Helix-turn-helix 
   1::71


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKSDGRRIILGKTIKMLREEQHLSQRRFALMVGTNQTHLWQIECGQVSVGIDLLCRIADGLDIKVKDLID
PF01381         -------------lkelRkqlglsqeeLAeklGvsrstisriEnGernPsletlkklakaLgvslde---


                         -         -         *         -         -         -         -:140
query           F---------------------------------------------------------------------
PF01381         ----------------------------------------------------------------------