[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for elen0:ACV55454.1


[Show Plain Result]

## Summary of Sequence Search
   1::1228
 393::518  PF00005 0.0% 30.0884955752212  ABC transporter 
1011::1136 PF00005 0.0% 30.7017543859649  ABC transporter 
  28::306  PF00664 0.0% 15.8671586715867  ABC transporter transmembrane region 
 694::924  PF00664 0.0% 18.7772925764192  ABC transporter transmembrane region 
 381::396  PF02463 0.0% 56.25  RecF/RecN/SMC N terminal domain 
 489::559  PF02463 0.0% 29.5774647887324  RecF/RecN/SMC N terminal domain 
 998::1177 PF02463 0.0% 30.0578034682081  RecF/RecN/SMC N terminal domain 
 374::398  PF09818 0.0% 45.8333333333333  Predicted ATPase of the ABC class 
 467::518  PF09818 0.0% 29.4117647058824  Predicted ATPase of the ABC class 
1088::1136 PF09818 0.0% 37.5  Predicted ATPase of the ABC class 
 379::403  PF03193 0.0% 36  Protein of unknown function, DUF258 
 987::1013 PF03193 0.0% 34.6153846153846  Protein of unknown function, DUF258 
 384::467  PF07728 0.0% 25.6410256410256  AAA domain (dynein-related subfamily) 
1002::1020 PF07728 0.0% 52.6315789473684  AAA domain (dynein-related subfamily) 
 384::434  PF00004 0.0% 26.530612244898  ATPase family associated with various cellular acti 
1002::1022 PF00004 0.0% 42.8571428571429  ATPase family associated with various cellular acti 
 381::402  PF03205 0.0% 40.9090909090909  Molybdopterin guanine dinucleotide synthesis protei 
1000::1019 PF03205 0.0% 35  Molybdopterin guanine dinucleotide synthesis protei 
 381::404  PF05729 0.0% 37.5  NACHT domain 
 999::1021 PF05729 0.0% 43.4782608695652  NACHT domain 
 384::401  PF00910 0.0% 61.1111111111111  RNA helicase 
1002::1062 PF00910 0.0% 32.1428571428571  RNA helicase 
   1::1228


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSKESKGRKPGALSRCLRFAGRRKPLVFASMALAVLSAAASFVPYVAIYFMIRDAVGVYPNLAAVDVSAM
PF00005         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF00664         ---------------------------llailllilagvtalv....fplllgrlldsvsdgndeerssl
PF00664         ---------------------------llailllilagvtalv....fplllgrlldsvsdgndeerssl
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF00910         ----------------------------------------------------------------------
PF00910         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           TGYAGLAVAGIVVDVGCYLAALLCSHAAAFDAQYRTKLDIAAHLGRIPLGHIARLGTGRISKVMDESVGG
PF00005         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF00664         yslailliavgvlivlllqgsfyllertgqrirkrlfrallrkilglfdsffdknsvGellsrltnDvsk
PF00664         yslailliavgvlivlllqgsfyllertgqrirkrlfrallrkilglfdsffdknsvGellsrltnDvsk
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF00910         ----------------------------------------------------------------------
PF00910         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           IEQFIGHSIPDLAATAAAPVVLAALLFVFDWRFGVATLAAVAVACVVQFSGYADKRVMASMGRYQEVKEQ
PF00005         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF00664         irdglgdklglffqslatfvgglivmfylgwkltlvllailpllilv..savlakilkslqkkeqkayak
PF00664         irdglgdklglffqslatfvgglivmfylgwkltlvllailpllilv..savlakilkslqkkeqkayak
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF00910         ----------------------------------------------------------------------
PF00910         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           MGNASVEYVRGMRVVKAFGQTARSFKRLSDAIKDYTGLSLDVTLFFRNSMPGFTAVLNNAYLFVLPVGIL
PF00005         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF00664         agavaeEalsgirtVkafggeekeleryekaleeakkagikkaitagllfg.ftqlisylsyalalwfgt
PF00664         agavaeEalsgirtVkafggeekeleryekaleeakkagikkaitagllfg.ftqlisylsyalalwfgt
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF00910         ----------------------------------------------------------------------
PF00910         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LAPGAQDWPTFVLSLVFYLLFVHSISSVFTKILYVSEDGMLAQANIDRIDSVLGIEELSCPEAPKAPKDA
PF00005         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF00664         fl.svisgelsvgtvfaflslglqls--------------------------------------------
PF00664         fl.svisgelsvgtvfaflslglqls--------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF00910         ----------------------------------------------------------------------
PF00910         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           SVSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREM
PF00005         ------------------------------------------STLlklltgelkptegeievdn.drkdl
PF00005         ------------------------------------------STLlklltgelkptegeievdn.drkdl
PF00664         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------
PF02463         ------------------------------ftaivGpNGSGKsnvl------------------------
PF02463         ------------------------------ftaivGpNGSGKsnvl------------------------
PF02463         ------------------------------ftaivGpNGSGKsnvl------------------------
PF09818         -----------------------lgipkG.itlIvGggyhGKsTLLeA----------------------
PF09818         -----------------------lgipkG.itlIvGggyhGKsTLLeA----------------------
PF09818         -----------------------lgipkG.itlIvGggyhGKsTLLeA----------------------
PF03193         ----------------------------dktsvlvGqSGvGKSsLinallpel-----------------
PF03193         ----------------------------dktsvlvGqSGvGKSsLinallpel-----------------
PF07728         ---------------------------------LvGppGtgKselaerlaeal....nreveyvqltrdt
PF07728         ---------------------------------LvGppGtgKselaerlaeal....nreveyvqltrdt
PF00004         ---------------------------------lyGppGtGKTllakavakelgve..fleisgsellsk
PF00004         ---------------------------------lyGppGtGKTllakavakelgve..fleisgsellsk
PF03205         ------------------------------ivlvvGpkdsGKTTliekllni------------------
PF03205         ------------------------------ivlvvGpkdsGKTTliekllni------------------
PF05729         ------------------------------tvilqGeaGsGKTtLlqklasawa----------------
PF05729         ------------------------------tvilqGeaGsGKTtLlqklasawa----------------
PF00910         ---------------------------------lyGpsgeGKStlakeLak-------------------
PF00910         ---------------------------------lyGpsgeGKStlakeLak-------------------


                         -         -         +         -         -         -         -:490
query           GQDELMGSLSLVFQDSHLFRESVAENIRRGRPGATDDEVVEAAKAAQADAFINGLPHGYATVIGSEGVHL
PF00005         esdkleklr..igyipqdpllfpeltvrenldmakeekktdkrieevlekvgldelldk..........s
PF00005         esdkleklr..igyipqdpllfpeltvrenldmakeekktdkrieevlekvgldelldk..........s
PF00664         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------
PF02463         --------------------------------------------------------------------lL
PF02463         --------------------------------------------------------------------lL
PF02463         --------------------------------------------------------------------lL
PF09818         ----------------------------------------------dispFinnLPegkdtt.efstedA
PF09818         ----------------------------------------------dispFinnLPegkdtt.efstedA
PF09818         ----------------------------------------------dispFinnLPegkdtt.efstedA
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF07728         teedlkgrreia.ngttslvdsplvraarege.ilvlDEveraesev-----------------------
PF07728         teedlkgrreia.ngttslvdsplvraarege.ilvlDEveraesev-----------------------
PF00004         yvgesekkirelfk--------------------------------------------------------
PF00004         yvgesekkirelfk--------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF00910         ----------------------------------------------------------------------
PF00910         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           SGGEQQRIAIARSIISDAPIVVLDEATAFSDPENEHLIQKAFERLMAGKTVIMVAHRLSTVVGADKIVVL
PF00005         rvstLSgGqkqrvalArallkkpklllL------------------------------------------
PF00005         rvstLSgGqkqrvalArallkkpklllL------------------------------------------
PF00664         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------
PF02463         SgGektLvalaLlfAiqkvkpaplyllDeidaaLDeknvskvaellkeksknaQfivislreemlekad-
PF02463         SgGektLvalaLlfAiqkvkpaplyllDeidaaLDeknvskvaellkeksknaQfivislreemlekad-
PF02463         SgGektLvalaLlfAiqkvkpaplyllDeidaaLDeknvskvaellkeksknaQfivislreemlekad-
PF09818         SGStsqAanimealeagakllLiDEDts------------------------------------------
PF09818         SGStsqAanimealeagakllLiDEDts------------------------------------------
PF09818         SGStsqAanimealeagakllLiDEDts------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF00910         ----------------------------------------------------------------------
PF00910         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           DGGRKVEEGTHQELLAASGTYAKMWRQYTEAVEWGIEAAPRDDTRSSEATAPHATQGVSAEEYDPAEKPG
PF00005         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF00910         ----------------------------------------------------------------------
PF00910         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           KPSSGRAPWLQRTFNLSDEGYVGLKRSAIACTLSDLALMIPFVCTVAAFAALVGTLAGEPFDAAALWSIF
PF00005         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF00664         ---------------------------------------------------------------sslysla
PF00664         ---------------------------------------------------------------sslysla
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF00910         ----------------------------------------------------------------------
PF00910         ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           AVGLAGMVVVFVASRNDYKKTYVAAYTESEGTRLRLADHLRKLPMSFFNRRDTTDVADRIMGDVTAQESM
PF00005         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF00664         il.liavgvlivlllqgsfyllertgqrirkr.lfrallrkilglfdsffdknsvGellsrltnDvskir
PF00664         il.liavgvlivlllqgsfyllertgqrirkr.lfrallrkilglfdsffdknsvGellsrltnDvskir
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF00910         ----------------------------------------------------------------------
PF00910         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           LSSTLPQLIAGIVSTVVICAMLAFFDWRLACCVMVTLPLSAGVIALSRRHQSRLFERQNRVRLDALACVQ
PF00005         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF00664         dglgdklglffqslatfvgglivmfylgwkltlvllailpllilvsavlakilkslqkkeqkayakagav
PF00664         dglgdklglffqslatfvgglivmfylgwkltlvllailpllilvsavlakilkslqkkeqkayakagav
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF00910         ----------------------------------------------------------------------
PF00910         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           DYLEGIKDMRACRAVGKDSAAMEQAMLELKRVTMRVELAVDVSVSLASAILRSGVGLTACVGAVLLASGG
PF00005         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF00664         aeEalsgirtVkafggeekeleryekaleeakkagikkaitagllfgftqlisylsyalalwfgtflsvi
PF00664         aeEalsgirtVkafggeekeleryekaleeakkagikkaitagllfgftqlisylsyalalwfgtflsvi
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF00910         ----------------------------------------------------------------------
PF00910         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:980
query           VDFMVLLMFLLIVSRVYGPILALVSQLPNLLNLSTKTARIKAVMDEPEARGSASADVPGHDLSFQGVRFG
PF00005         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF00664         sgelsvgtvfafls--------------------------------------------------------
PF00664         sgelsvgtvfafls--------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF00910         ----------------------------------------------------------------------
PF00910         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:1050
query           YGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLAHVSIV
PF00005         ------------------------------STLlklltgelkptegeievd.ndrkdlesdkleklr.ig
PF00005         ------------------------------STLlklltgelkptegeievd.ndrkdlesdkleklr.ig
PF00664         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------
PF02463         -----------------sftaivGpNGSGKsnvld.AilFvLGeksakklrseklsdlihkskskakvks
PF02463         -----------------sftaivGpNGSGKsnvld.AilFvLGeksakklrseklsdlihkskskakvks
PF02463         -----------------sftaivGpNGSGKsnvld.AilFvLGeksakklrseklsdlihkskskakvks
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF03193         ------leelaellkd.ktsvlvGqSGvGKSsL-------------------------------------
PF03193         ------leelaellkd.ktsvlvGqSGvGKSsL-------------------------------------
PF07728         ---------------------LvGppGtgKselaerlaea------------------------------
PF07728         ---------------------LvGppGtgKselaerlaea------------------------------
PF00004         ---------------------lyGppGtGKTllakavakelg----------------------------
PF00004         ---------------------lyGppGtGKTllakavakelg----------------------------
PF03205         -------------------vlvvGpkdsGKTTlieklln-------------------------------
PF03205         -------------------vlvvGpkdsGKTTlieklln-------------------------------
PF05729         ------------------tvilqGeaGsGKTtLlqklasaw-----------------------------
PF05729         ------------------tvilqGeaGsGKTtLlqklasaw-----------------------------
PF00910         ---------------------lyGpsgeGKStlakeLakall.kkl..klkkkdsvysrnpeddfwdgYt
PF00910         ---------------------lyGpsgeGKStlakeLakall.kkl..klkkkdsvysrnpeddfwdgYt


                         -         -         -         -         *         -         -:1120
query           FQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVLGENGASLSGGERQRLSIAR
PF00005         yipqdpllfpeltvrenldmakeekktdkrieevlekvgldelldk..........srvstLSgGqkqrv
PF00005         yipqdpllfpeltvrenldmakeekktdkrieevlekvgldelldk..........srvstLSgGqkqrv
PF00664         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------
PF02463         aeveitfdnedkelvieeeevsitrrvkrkgeseykingkevtkkevaellesagiske......lLSgG
PF02463         aeveitfdnedkelvieeeevsitrrvkrkgeseykingkevtkkevaellesagiske......lLSgG
PF02463         aeveitfdnedkelvieeeevsitrrvkrkgeseykingkevtkkevaellesagiske......lLSgG
PF09818         -------------------------------------pFinnLPegkdtt.efstedASGStsqAanime
PF09818         -------------------------------------pFinnLPegkdtt.efstedASGStsqAanime
PF09818         -------------------------------------pFinnLPegkdtt.efstedASGStsqAanime
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF00910         ..gqevvvidDf----------------------------------------------------------
PF00910         ..gqevvvidDf----------------------------------------------------------


                         -         -         +         -         -         -         -:1190
query           ALLKDAPVVLLDEATASLDPENETLIQRAVGTLCAGKTVIVIAHRLRTVANADKIVVLDSGRVAEEGNHK
PF00005         alArallkkpklllLD------------------------------------------------------
PF00005         alArallkkpklllLD------------------------------------------------------
PF00664         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------
PF02463         ektLvalaLlfAiqkvkpaplyllDeidaaLDeknvskvaellkeksknaQfivisl-------------
PF02463         ektLvalaLlfAiqkvkpaplyllDeidaaLDeknvskvaellkeksknaQfivisl-------------
PF02463         ektLvalaLlfAiqkvkpaplyllDeidaaLDeknvskvaellkeksknaQfivisl-------------
PF09818         aleagakllLiDEDts------------------------------------------------------
PF09818         aleagakllLiDEDts------------------------------------------------------
PF09818         aleagakllLiDEDts------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF00910         ----------------------------------------------------------------------
PF00910         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:1260
query           TLLAEDGLYARLWRLQQESSSWTVPADRGDAADVPTGR--------------------------------
PF00005         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF00910         ----------------------------------------------------------------------
PF00910         ----------------------------------------------------------------------