[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for elen0:ACV55525.1


[Show Plain Result]

## Summary of Sequence Search
   1::948
  29::655  PF00133 0.0% 41.5959252971138  tRNA synthetases class I (I, L, M and V) 
 700::865  PF08264 0.0% 33.7748344370861  Anticodon-binding domain 
  59::203  PF09334 0.0% 28.6821705426357  tRNA synthetases class I (M) 
 409::483  PF09334 0.0% 19.1780821917808  tRNA synthetases class I (M) 
 595::662  PF09334 0.0% 37.3134328358209  tRNA synthetases class I (M) 
 587::662  PF01406 0.0% 32  tRNA synthetases class I (C) catalytic domain 
  40::97   PF01921 0.0% 26.3157894736842  tRNA synthetases class I (K) 
 592::674  PF01921 0.0% 18.2926829268293  tRNA synthetases class I (K) 
 188::193  PF06827 0.0% 50  Zinc finger found in FPG and IleRS 
 911::935  PF06827 0.0% 48  Zinc finger found in FPG and IleRS 
   1::948


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MANTYKETMNLPKTDFAMRANLPESEPKRLAKWEEEHIYEQVLEKNKDGKPFILHDGPPYANGPIHIGHA
PF00133         ----------------------------ilekWeeedlfkkslekekekekFvlvdgPPnatGslHiGha
PF08264         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------pYvngkpHlGhl
PF09334         ----------------------------------------------------------pYvngkpHlGhl
PF09334         ----------------------------------------------------------pYvngkpHlGhl
PF01406         ----------------------------------------------------------------------
PF01921         ---------------------------------------eklieerkkkkk.ekdevvvesGispSGliH
PF01921         ---------------------------------------eklieerkkkkk.ekdevvvesGispSGliH
PF06827         ----------------------------------------------------------------------
PF06827         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           FNKILKDFVNKSHAQRGFFTPYVPGWDCHGQPIEHMVEKTLGPDKMAKIDQPTLRRLCREWAEKYVDVQR
PF00133         laktlkdivirykrmkGkdveyvpGwDhhGlpieakvekklgkkekkereklgrekfrekvrewkaeyae
PF08264         ----------------------------------------------------------------------
PF09334         ystiaaDvlarykrlrgeevlfvtgtDehGtkielkAeke..........gltp....qelvdkvseefk
PF09334         ystiaaDvlarykrlrgeevlfvtgtDehGtkielkAeke..........gltp....qelvdkvseefk
PF09334         ystiaaDvlarykrlrgeevlfvtgtDehGtkielkAeke..........gltp....qelvdkvseefk
PF01406         ----------------------------------------------------------------------
PF01921         iGnlrevltadlvakalrkrgeevrli-------------------------------------------
PF01921         iGnlrevltadlvakalrkrgeevrli-------------------------------------------
PF06827         ----------------------------------------------------------------------
PF06827         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           EGFKRLGVNADWEHPYLTFTPNYEAGNVEVFKRMYLDGSVYRGRKPIHWCKRCHTALAEAEIEYSDETSP
PF00133         eirkqvkrLGvsvdwdreylTldeeleeavievfvelakkGliyrgkklvnwstklktalselEveykdv
PF08264         ----------------------------------------------------------------------
PF09334         elfkklnisfD..kfirTtseehkelvqeffkklkekgliyekeieqlYcvsderflpdryve-------
PF09334         elfkklnisfD..kfirTtseehkelvqeffkklkekgliyekeieqlYcvsderflpdryve-------
PF09334         elfkklnisfD..kfirTtseehkelvqeffkklkekgliyekeieqlYcvsderflpdryve-------
PF01406         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------
PF06827         -----------------------------------------------flCpRC-----------------
PF06827         -----------------------------------------------flCpRC-----------------


                         -         -         -         +         -         -         -:280
query           SIFVKFKMDIMPGMFETAGAAGDAYVLIWTTTPWTLPANTAVSLAPDADYVMVQADGSNMIMARELVEQV
PF00133         kdalihvafpl...........adkke..aklviwTTtPwTllgntavavnpeleyv...vedellilae
PF08264         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------
PF06827         ----------------------------------------------------------------------
PF06827         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           AEIAGWESYDLVRGEDGEPVALKGREFTGLTYTCPVRQDLKGTIIYGDHVTLDSGTGAVHTAPGHGQDDY
PF00133         allesllkkkkee...........ledergkeLegkkvelpl.ldreipiiadeyvdkeaGtGiVkiaPa
PF08264         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------
PF06827         ----------------------------------------------------------------------
PF06827         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           LVALEFDVPLLMPVDDNGVLTDEAGPFAGLDVDEANPVIIEWLRERGTLVAQKEILHSYPHCWRCHEPVI
PF00133         hgedDyevgkkhnlevinvldedGtlneeaeefeglkrfkarkkiveeLkekglllkkekiehsypfcwr
PF08264         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------npksaisgskpe
PF09334         ----------------------------------------------------------npksaisgskpe
PF09334         ----------------------------------------------------------npksaisgskpe
PF01406         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------
PF06827         ----------------------------------------------------------------------
PF06827         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           FRATDQWFVSMDKNSLRENALKAIENDVEWIPAWASNRIGSMVADRPDWCISRQRSWGVPIPVFKCAKCG
PF00133         sktpiiyrateqWfvkvke..laeaalkave.kvkfvpkskekrykswleniqdWcisRqrwWGtripvw
PF08264         ----------------------------------------------------------------------
PF09334         vkeeehyffklsk..feeklkewikenkelpkenvkevlkewlkegLkdlsisrdlkwGipvp-------
PF09334         vkeeehyffklsk..feeklkewikenkelpkenvkevlkewlkegLkdlsisrdlkwGipvp-------
PF09334         vkeeehyffklsk..feeklkewikenkelpkenvkevlkewlkegLkdlsisrdlkwGipvp-------
PF01406         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------
PF06827         ----------------------------------------------------------------------
PF06827         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           STVANEQTFDAVIDLFYREGADAWFTREPSEYLPRGVKCETCGCTELTPEKDILDVWWESGVSHTSVLKH
PF00133         vsketeevvvreelkelvakrleeeaeekalekeakdkl.......kkekgklekdedvlDvWFdSgstp
PF08264         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------
PF06827         ----------------------------------------------------------------------
PF06827         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           REAEGLRFPADMYLEGSDQHRGWFQSSLLTSMGAYGVPPYKAVMHCGFTVDGEGRKMSKSLGNGVDPAEV
PF00133         fsvlgypeentkefkkffpadllleGlDqirgWvarlillslaltgkepykevlvhglvldeeGrKMSKs
PF08264         ----------------------------------------------------------------------
PF09334         ----------------------------------aglklpkkvvahgylt.vegekmSkSrgnvvdpeel
PF09334         ----------------------------------aglklpkkvvahgylt.vegekmSkSrgnvvdpeel
PF09334         ----------------------------------aglklpkkvvahgylt.vegekmSkSrgnvvdpeel
PF01406         --------------------------elaqseaafdkqlvkywlhngh.lkiegekmsksLknfltikdv
PF01921         -------------------------------eeilggeaPvgvvYelillkgge.kmssSkGnvitvedw
PF01921         -------------------------------eeilggeaPvgvvYelillkgge.kmssSkGnvitvedw
PF06827         ----------------------------------------------------------------------
PF06827         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           MAKSGADVLRLWVASVDYSQDVSISDEILQRTSEAYRRIRNTFRFLLGSLDDFDDQKDAVSDWNALEPLD
PF00133         lgNvidpldvikkygadalRltlia---------------------------------------------
PF08264         ---------------------------------------------------------------------d
PF09334         leelgvdalRYyllreapekkDsdfseeelve--------------------------------------
PF09334         leelgvdalRYyllreapekkDsdfseeelve--------------------------------------
PF09334         leelgvdalRYyllreapekkDsdfseeelve--------------------------------------
PF01406         lkkfdprqlRllllsahyrsqldfkeelleea--------------------------------------
PF01921         levaepevlrfliarkkPkkakkldldleilklvdeYdrlerky--------------------------
PF01921         levaepevlrfliarkkPkkakkldldleilklvdeYdrlerky--------------------------
PF06827         ----------------------------------------------------------------------
PF06827         ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           QWAMVRTKHLLDDVSAAYDAYKFHYVYRAVYDYIVNDLSAVYMDATKDRLYSEAPDSPRRRAVQTVLMNI
PF00133         ----------------------------------------------------------------------
PF08264         rwilselnelikevteayeeyrfnkavsalyeffwndlcdwylelvkprlysesaeds.rr.aqyvllev
PF09334         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------
PF06827         ----------------------------------------------------------------------
PF06827         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           LEVLVRVLAPVLSFTTDEVWEHYPQAMRERAGRPTNVQLAGWPKASDFAPAIPADGERVSEDFGVIMGVR
PF00133         ----------------------------------------------------------------------
PF08264         letllrllaPimPfltEelwqrl...eeeklgkeesimlaewpedseel.....ekea.....eeevell
PF09334         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------
PF06827         ----------------------------------------------------------------------
PF06827         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           EVVTKALEDARGQKVVNKSQEAAVVVTAPRAVLDAVERYDAAVFEELFIVASVSFAEGEELAATVSKTEA
PF00133         ----------------------------------------------------------------------
PF08264         keivkairklrkelkikpseevkvv---------------------------------------------
PF09334         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------
PF06827         ----------------------------------------------------------------------
PF06827         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:980
query           EKCPRCWNHRALGGNANHGSVCERCGDALDAIGFAEGE--------------------------------
PF00133         ----------------------------------------------------------------------
PF08264         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------
PF06827         ekCpRCwnyiervgqggrstflCpR---------------------------------------------
PF06827         ekCpRCwnyiervgqggrstflCpR---------------------------------------------