[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for elen0:ACV55587.1


[Show Plain Result]

## Summary of Sequence Search
   1::352
   7::327  PF00154 0.0% 70.0934579439252  recA bacterial DNA recombination protein 
  40::197  PF06745 0.0% 26.4900662251656 PF06745 KaiC 
  39::227  PF08423 0.0% 31.5217391304348 PF08423 Rad51 
  60::97   PF01637 0.0% 34.2105263157895  Archaeal ATPase 
   1::352


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESS
PF00154         ------kaleaalkqiekqfGkgsimrlgdkeekeevevistgslaldialGiGGlPkGriieiyGpess
PF06745         ---------------------------------------vktgIeglDell.kgGipegrvvlitGepGt
PF08423         --------------------------------------kittGskeldkllg.GGietgsitevfGefrt
PF01637         -----------------------------------------------------------siiviyGprrs


                         -         -         *         -         -         -         -:140
query           GKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVRSGAIDA
PF00154         GkttlalhaiaeaqkkggvaafidaehaldpkyakklGvdidellvsqPdtGeqaleiadalvrsgavdl
PF06745         GKtifalqFlikgaeeygepgvfvtveesaedlrenakslgwdlekleeegklaiidasesaeeea....
PF08423         GktqlchtlavtaqlplekgGgegkvlyidtegtfrperlvaiaerfgldseevldnvayaraynsehql
PF01637         GKTaLlkeileelkekgkrvvyyinlr-------------------------------------------


                         +         -         -         -         -         *         -:210
query           VVVDSVAALVPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQLREKIGVMFGNPETTT
PF00154         ivvdsvaalvPkaeieGemgdshvglqarlmsqalrkltgsisksntlvifinqirekiGvmfgnPettt
PF06745         .eedlee.lieklaeaikeikakrvviDsitglyeekeavaReilrqlvrvlkklgv-------------
PF08423         ellaeaaakmaeerfallivdsitaly.rtdfsGr.Gelae..rqqklakflrklqkladefnvavvitn
PF01637         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GGRALKFFSSVRIDIRRIDSIKKDGEIVGNRVRAKVVKNKVAPPFRQAEFDLMYGEGISREGCIVDMAVE
PF00154         GgralkfyasvrldirrieaikekeevvgnktkvkvvknkvapPfkeaeldilygeGisklgelvdlavk
PF06745         ----------------------------------------------------------------------
PF08423         qvvadvdgaalfaadek-----------------------------------------------------
PF01637         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           AGVAKKSGAWYTYGEERLGQGREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEADAMSPVAKPAK
PF00154         ldiveksGawysyeeekigqGkenakkylkenpelaeeiekkirekl-----------------------
PF06745         ----------------------------------------------------------------------
PF08423         ----------------------------------------------------------------------
PF01637         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           KK--------------------------------------------------------------------
PF00154         ----------------------------------------------------------------------
PF06745         ----------------------------------------------------------------------
PF08423         ----------------------------------------------------------------------
PF01637         ----------------------------------------------------------------------