[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for elen0:ACV55872.1


[Show Plain Result]

## Summary of Sequence Search
   1::183
   1::183


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSELLNQLWTPELQAAFTVVVVLLVILYVLSIVWVVRDAYLRGSYWYVWAIVALVPLLGIIAYCLLRPPL


                         -         -         *         -         -         -         -:140
query           LQIDRDEQELEIALKQRELMKYGECANCGYPVEADFVLCPNCHQRLKNLCGTCNHALDPTWTVCPYCATP


                         +         -         -         -         -         *         -:210
query           VAGGPRTRRAPQQRGARTQQPQQAATQQQTRQARPAQSEHGVQ---------------------------