[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for elen0:ACV55893.1


[Show Plain Result]

## Summary of Sequence Search
   1::501
   8::153  PF05697 0.0% 32.6388888888889  Bacterial trigger factor protein (TF) 
 243::257  PF05697 0.0% 33.3333333333333  Bacterial trigger factor protein (TF) 
 318::360  PF05697 0.0% 21.9512195121951  Bacterial trigger factor protein (TF) 
 276::433  PF05698 0.0% 25.9493670886076  Bacterial trigger factor protein (TF) C-terminus 
   1::501


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MMEDSYVETKVEALEDNRTKVTVTVDAADIDARIKKTYKDFANKYNFPGFRKGKAPRPIIDNALGAEAVR
PF05697         -------kvtvekleglevklevevpaeeiekkvdkalkelakkvkipGFRkGkvPrkvvkkrygke.ir
PF05697         -------kvtvekleglevklevevpaeeiekkvdkalkelakkvkipGFRkGkvPrkvvkkrygke.ir
PF05697         -------kvtvekleglevklevevpaeeiekkvdkalkelakkvkipGFRkGkvPrkvvkkrygke.ir
PF05698         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           ATVTDDVVNGTYPLAIDDCDLYPIAKPEFDETDLVEAGKPYTFSFTVTVKPEIEISSYEPVEIELPAEGT
PF05697         eealnellqealeealkeekleplgqpeieeke.lkeekdlefevevevyPevelkdykglevekpevev
PF05697         eealnellqealeealkeekleplgqpeieeke.lkeekdlefevevevyPevelkdykglevekpevev
PF05697         eealnellqealeealkeekleplgqpeieeke.lkeekdlefevevevyPevelkdykglevekpevev
PF05698         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           TDAEIDEQIDALREHYYSFEDASAATKVKEDSYIDLAMKATDDKGEEIPSLTTENRPYGLGANLFPAEFD
PF05697         teedvdeeleklr---------------------------------------------------------
PF05697         teedvdeeleklr---------------------------------------------------------
PF05697         teedvdeeleklr---------------------------------------------------------
PF05698         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           EQLVGLKKGQTATFTLDMPADPPIMLSALAGKTEKINFEVEVKVVKKKIVPEVNDEWAKEQMGFESVEDL
PF05697         --------------------------------vekpevevteedvde-----------------------
PF05697         --------------------------------vekpevevteedvde-----------------------
PF05697         --------------------------------vekpevevteedvde-----------------------
PF05698         -----------------------------------------------------------------tLeeL


                         -         *         -         -         -         -         +:350
query           RARIAESVTSQKADMMPRLKENACLYALAERVEGDVPEAMLEDAEASLIQDFFQQLQSQGMTFDVYLAQQ
PF05697         -------------------------------------keireealnellqealeealkeekle..plgqp
PF05697         -------------------------------------keireealnellqealeealkeekle..plgqp
PF05697         -------------------------------------keireealnellqealeealkeekle..plgqp
PF05698         keklrkqleeekkeatkeelkeaildkLvekaeielPeslveeeierllrqflqqleqqgldleeylsls


                         -         -         -         -         *         -         -:420
query           GITPDQFKEDVKKQAEDMSKQDLALDAWARHFGMEATAEEVTEEFVKSGVEDPAALEAEWRSNGQLHMVR
PF05697         eieekelkee------------------------------------------------------------
PF05697         eieekelkee------------------------------------------------------------
PF05697         eieekelkee------------------------------------------------------------
PF05698         gsseeelreelkeeAekrvklgLileeiakeekievteeeikeeieelasqygmepeevkefykkneqls


                         -         -         +         -         -         -         -:490
query           QGVIRTKAVKDIMDKAVVTELDLSKKKDEEKKPAKKAAAKKTAKKDEAAGDEPAKKPAKKAAPKKAAKKD
PF05697         ----------------------------------------------------------------------
PF05697         ----------------------------------------------------------------------
PF05697         ----------------------------------------------------------------------
PF05698         alkedlleekvvd---------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           EDVEAKADDAE-----------------------------------------------------------
PF05697         ----------------------------------------------------------------------
PF05697         ----------------------------------------------------------------------
PF05697         ----------------------------------------------------------------------
PF05698         ----------------------------------------------------------------------