[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for elen0:ACV55970.1


[Show Plain Result]

## Summary of Sequence Search
   1::142
  18::112  PF02410 0.0% 45.2631578947368  Domain of unknown function DUF143 
   1::142


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSTTTTEKTSRECALIAACAADEKKATDIMVQEVRDLIGVTDYFVIATASNNRQVEAIIDEIEDAVRTKA
PF02410         -----------------vkaleekkaedivvldvsekssiadyfviatgkserhvkaiadevekelekek


                         -         -         *         -         -         -         -:140
query           QMKPLHREGTQDGTWSLLDYGSFVVHVFQPETREYYRLEALWNDAPVIDLAAEAGLTDIEYSDRIAKMLG
PF02410         gdellkvegldeseWvllDlgdivvhifteeaReeynLEslW----------------------------


                         +         -         -         -         -         *         -:210
query           KE--------------------------------------------------------------------
PF02410         ----------------------------------------------------------------------