[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for elen0:ACV56026.1


[Show Plain Result]

## Summary of Sequence Search
   1::278
  10::264  PF02110 0.0% 47.1311475409836  Hydroxyethylthiazole kinase family 
  66::216  PF08543 0.0% 26.4285714285714  Phosphomethylpyrimidine kinase 
   1::278


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEPFALKRALDNVRATTPLVHNITNYVTVNDCANALLAIGASPIMSDEPADVFDITSICGGLTLNIGTLN
PF02110         ---------lkkvrekrPlvhniTNkVaqnfsANvllAlgaSPvmseaeeEvselakiadalviNiGtle
PF08543         -----------------------------------------------------------------iGmla


                         -         -         *         -         -         -         -:140
query           ERSIQGMFAAGERASELGHPIVLDPVGAGASALRTRTASDLLDKLAVSVVRGNMSEAKALAGGAAATRGV
PF02110         ekaiealkaAvksanelgkPvvlDPVgvgAtelRtevalellkevkvavikGNasEilslageelkvkGv
PF08543         saeiievvaekl..kkykvpvVlDPvmvaksgdslleeeavealkeeLlplatlvtPNlpEaeaLlg.rk


                         +         -         -         -         -         *         -:210
query           DVCPGDAVTEDNLAAGAAFARDFAAKTGAVVAVTGAIDIVADAERAYAVRNGSPLMGRITGAGCMLSCVC
PF02110         Dsseaa..te....a.vkavqkvArklrtvvvvtGevDvvsdgkkvlkiknGtellgkitasGCllgavv
PF08543         ik.......teedmkeaakkllelgakavlvkGghleg.eeavvtdvlydegeveeleaerietknthGt


                         -         -         -         +         -         -         -:280
query           AAFATANPDALLDATVAAVVGMGLAGQIAQGRMGGYDGNGSFRTYLLDALYNLDGDALEAGARVEELA--
PF02110         aaflavkkdkllaa.veavllykiAgekaaersegs...gsFqvelldalyqlt----------------
PF08543         GCtlsa----------------------------------------------------------------