[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for elen0:ACV56092.1


[Show Plain Result]

## Summary of Sequence Search
   1::166
   9::67   PF03946 0.0% 67.7966101694915  Ribosomal protein L11, N-terminal domain 
  72::140  PF00298 0.0% 53.6231884057971  Ribosomal protein L11, RNA binding domain 
   1::166


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAEKKQTGFIKLQIPAGAANPAPPVGPALGAQGVNIMQFCQAFNAQTQDQSGTIIPVEITVYEDKSFTFV
PF03946         --------viklqveaGkAnpaPplGpaLGplGvnimefckefnaaTkdykkGlpvpVkItvyndks---
PF00298         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           CKTPPAAVLIKEKLNINSGSGLPHVQPVGTLTEDQLREIAEIKMPDLNANTIEAAMEIIAGTARSMGVRI
PF03946         ----------------------------------------------------------------------
PF00298         -ktPpasvlLkkaagiekGsgkpgkekvGkitlkqvyeIAkiKksdlnaldleaavksiiGtArsmGikV


                         +         -         -         -         -         *         -:210
query           EGREMKIKYVPSKKVAAMLQGKTLED--------------------------------------------
PF03946         ----------------------------------------------------------------------
PF00298         ----------------------------------------------------------------------