[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for elen0:ACV56185.1


[Show Plain Result]

## Summary of Sequence Search
   1::280
 106::275  PF01729 0.0% 38.5542168674699  Quinolinate phosphoribosyl transferase, C-terminal 
  17::104  PF02749 0.0% 30.6818181818182  Quinolinate phosphoribosyl transferase, N-terminal 
   1::280


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLRISDTRIDGFIAEDVPYVDLTCAVLGIGDEPGEMEYFTREDCVLAGANVVARIMGKLGCDVVEARRDG
PF01729         ----------------------------------------------------------------------
PF02749         ----------------igsgDittealipeeqratasliakeegvvaGlevveevfeqlglevewlvkdG


                         -         -         *         -         -         -         -:140
query           ERATAGEAFFRVRGTAGDLHAAWKVCLNVFDHMSAVATKTRAMVDAAHAENPRCEVLTTRKSMPGAKDLL
PF01729         -----------------------------------iAtatakmveaakst..kvkildTRkttPglrlle
PF02749         erveagevlltieGnaralltaERvaLnllqrlS------------------------------------


                         +         -         -         -         -         *         -:210
query           TEAVMAGGAFPHRLGLSETVLVFDHHLTFFGGFEAFVEQLPDIKGRCVEKKLFVEADAERARVLARAGVD
PF01729         kyavliGGgdnhrlgLsdavlikdnhiaaagsieeavksarevvdkevk..vevevenleeleealeaga
PF02749         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GIQVDKVPVDELEPLVRELRAIDPHVTLIAAGGVNPQNAGAYAATGVDGLATTAPFSAKPLDMSVRMRPL
PF01729         diimLDnfsveelkeaveelkelagrvllevSGgvtlenveeyaktgvdvisvgalthsvkalDl-----
PF02749         ----------------------------------------------------------------------