[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for elen0:ACV56208.1


[Show Plain Result]

## Summary of Sequence Search
   1::160
  72::116  PF05154 0.0% 46.6666666666667  TM2 domain 
   1::160


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQYANINDAQAAMTSDQYVGLNADGTYGLFDRAQNPQWVGACQYAYQVAGVPFPNGLYGVGMTATATVEP
PF05154         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           AGKRKLFALLLWLFLGVWGGHDFYAGKKWLGVAHVLLFFAWLWMLFFGVLIPINGYEFFAFLILLVLCAM
PF05154         -kksklvAylLwffLGglGvHRFYlGkvgsGilqlltfvGilgiww------------------------


                         +         -         -         -         -         *         -:210
query           TFVELLALLISSKYGECSRW--------------------------------------------------
PF05154         ----------------------------------------------------------------------