[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for elen0:ACV56217.1


[Show Plain Result]

## Summary of Sequence Search
   1::295
  11::174  PF01734 0.0% 25  Patatin-like phospholipase 
   1::295


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MMTSTVHDVALVFEGGGMRNSYSAGAIGVMLEQGLFFDDVYGLSAGATNAIDYVSRDARRNEASFTACLD
PF01734         ----------LvlsGGGtrGafslgalkaLkkelgdrfdiisGtSaGaiiaallalgrdpaalvedlrel


                         -         -         *         -         -         -         -:140
query           DLSFRWWVMPFVDADGVGAALHGDARVRSSCALPFDFDAFQANPARVTLQAIDRDTGETVCFTRGDFPTE
PF01734         llnkffdrdllirelaanlaarlsgllgpgglfdaealrellrkllgdltlkrlsarlgklpllkslata


                         +         -         -         -         -         *         -:210
query           QTLMERVRASTSYPIVLPPTVVDGRALYDGGIGRGGGIMVPRAMDDGLSRFFVVCTRPRGFRRPLKPNRF
PF01734         aqavpaittataasastanradslyteddeddvp------------------------------------


                         -         -         -         +         -         -         -:280
query           YDAFFWRRPRMREALDTWNRRYDAELDRLDRLEAEGRAYVFYANDQGVKNTERDAEKLARNYERGRMQAL
PF01734         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           SEFDRWERFLSGQGV-------------------------------------------------------
PF01734         ----------------------------------------------------------------------