[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for elen0:ACV56230.1


[Show Plain Result]

## Summary of Sequence Search
   1::264
  61::176  PF00005 0.0% 26.4150943396226  ABC transporter 
  37::218  PF02463 0.0% 26.7857142857143  RecF/RecN/SMC N terminal domain 
   1::264


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTITTRDSLLTIRGLSASVDETPILHDIDLAVGPGETHVIMGPNGAGKSTLGHVVMGDAAYRMDGGSVEF
PF00005         ------------------------------------------------------------lkptegeiev
PF02463         ------------------------------------ftaivGpNGSGKsnvldAilFvLGeksakklrse


                         -         -         *         -         -         -         -:140
query           DGRDITDLSPDKRSRAGLFLSFQAPVEIPGVPLSSFLRATVAGRDGKELKGKQFKKHVRTLADELDMDPS
PF00005         d.ndrkdlesdkleklrigyipqdpllf...peltvrenldmakeekk.....tdkrieevlekvglde.
PF02463         kls...dlihkskskakvksaeveitfdnedkelvieeeevsitrrvkrkgeseykingkevtkkevael


                         +         -         -         -         -         *         -:210
query           YLDRELGVGFSGGEKKKLEMLQLLLLEPKLAILDETDSGLDVDALGVVSRGIDAYRRATGGALVVITHNT
PF00005         lldksrvstLSgGqkqrvalArallkkpklllLDEP----------------------------------
PF02463         lesagiske........lLSgGek.tLvalaLlfAiqkvkpaplyllDeidaaLDeknvskvaellkeks


                         -         -         -         +         -         -         -:280
query           RILEHVDVDRVHVMVRGRMVAEGDSSLIESINEQGFEQFEQAGAEAAREPVAAL----------------
PF00005         ----------------------------------------------------------------------
PF02463         kn..aQfi--------------------------------------------------------------