[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for elen0:ACV56234.1


[Show Plain Result]

## Summary of Sequence Search
   1::144
   5::88   PF01592 0.0% 30.952380952381  NifU-like N terminal domain 
  92::135  PF01592 0.0% 23.8095238095238  NifU-like N terminal domain 
   1::144


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MASIYTAALMEHNAHPDYKYQMDEPTCTHDGVNPSCGDELTLSLRLRGDRIEEAAFTGHGCAVSQAAADM
PF01592         ----ysdkvldhfknPrnvGvleeadagvgevgapacGDalrLqlkvdeetdriedakFktfGCgsaiAs
PF01592         ----ysdkvldhfknPrnvGvleeadagvgevgapacGDalrLqlkvdeetdriedakFktfGCgsaiAs


                         -         -         *         -         -         -         -:140
query           MADLVTGETVGEARRLSGLYLDMIKGRPLTDEERADLDEAAELESIARMPARVKCAELAWRTLEKLLDQQ
PF01592         ssaltelvkgktleeAlk---elvkgktleeAlkitnkdiaeelgg..lpkekmhcsvlaeealk-----
PF01592         ssaltelvkgktleeAlk---elvkgktleeAlkitnkdiaeelgg..lpkekmhcsvlaeealk-----


                         +         -         -         -         -         *         -:210
query           LEKA------------------------------------------------------------------
PF01592         ----------------------------------------------------------------------
PF01592         ----------------------------------------------------------------------