[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for elen0:ACV56581.1


[Show Plain Result]

## Summary of Sequence Search
   1::109
  25::109  PF10665 0.0% 29.4117647058824  Phage protein Gp9 
   1::109


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLQIPKRALPSTAAVRVPLEGDYGGEFAEPVAIGHVRYEKAAGIRRTDYQLQDGTTGIVFIDAVNSEGAF
PF10665         ------------------------lsyakpvvIenvrvdpskkkssatsgrsvvynavvFidavnsnpll


                         -         -         *         -         -         -         -:140
query           EVPASSMVSIDGAPEVCVNACHPREQFAGRVHHWELEVR-------------------------------
PF10665         efkekskivfegkeykikkvipnyetfsetlhhyElevv-------------------------------