[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for elen0:ACV56675.1


[Show Plain Result]

## Summary of Sequence Search
   1::607
  24::86   PF10099 0.0% 28.8461538461538  Anti-sigma-K factor rskA 
 255::291  PF10099 0.0% 36.1111111111111  Anti-sigma-K factor rskA 
   1::607


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTDDPLTRYAALMNRANAPRELSRAVLDRIESQQSEQTRPTGATGSAAPRHQAGPAPTPFSVKRHRFRGF
PF10099         -----------------------palwdrIearlfaepa.........aaaaarsarlwr..rlrrWrgl
PF10099         -----------------------palwdrIearlfaepa.........aaaaarsarlwr..rlrrWrgl


                         -         -         *         -         -         -         -:140
query           AVAACLLLLAVLVGLSLAVPRFAKNAGPLGFAINAYGASGNSLLAMGEDGRILFEADILFRVPPDDRYAE
PF10099         alaaaAaaavlalall------------------------------------------------------
PF10099         alaaaAaaavlalall------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           EGVYTGCMFRIEGDDIVRVQAHIDKGELYRYTYDEFQAASNPDRWAEAQQWSTASIGEGAFFGAYDLVQP
PF10099         ----------------------------------------------------------------------
PF10099         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           VSSLSESEQPDNQTVGVKCYQRLGSTVDLPVNDEIGSRLSDYCFGLWTNEDAGAVTGYQDYIDTLDGATL
PF10099         --------------------------------------------Glldaeesgeltlpadlaaaaaaa.l
PF10099         --------------------------------------------Glldaeesgeltlpadlaaaaaaa.l


                         -         *         -         -         -         -         +:350
query           TVTIEKADGSHATKSIELTAADVKAKLVPSETNGTPALELIPQIVDPFEGDVQERLNKRSEGYTWIHTLY
PF10099         avtlEppGGsp-----------------------------------------------------------
PF10099         avtlEppGGsp-----------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           GTVAEENCEPFPFEGEQLQSLDRPLTEPASQPAVEPASAEPDEAVTPQDTWVVCKNPLRLGEAIDVRFPV
PF10099         ----------------------------------------------------------------------
PF10099         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           NVIDDQQASGGSTEGLLTCTNGTVATQLPTEVRLENLALPNPGDLDDSNKFFKANGGFTLDENGAPSDGY
PF10099         ----------------------------------------------------------------------
PF10099         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           AYAAIDITVRNTSDKTLYADATQGWFGTVKKMGGEQFFAQSEPSWPLWTSGIEHPIDSWNGNPFFVPIQP
PF10099         ----------------------------------------------------------------------
PF10099         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           GETKTFTVLHVVAASDLADPTFSYHYRNTSYGGRTTATYRIGALTLP-----------------------
PF10099         ----------------------------------------------------------------------
PF10099         ----------------------------------------------------------------------