[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for elen0:ACV56703.1


[Show Plain Result]

## Summary of Sequence Search
   1::471
  39::423  PF07690 0.0% 24.251497005988  Major Facilitator Superfamily 
 286::463  PF07690 0.0% 22.0858895705521  Major Facilitator Superfamily 
   1::471


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRWWETEGRRHAGMKRVKSERMGVYALFAIVVLASASGNLSQTAVNAMLGDIMLQFGLTVDLGQWLTTSY
PF07690         --------------------------------------alarsilgpalplalaedlgispseigwlltl
PF07690         --------------------------------------alarsilgpalplalaedlgispseigwlltl


                         -         -         *         -         -         -         -:140
query           MLVLGITVPVATFLSRRFSVRQHVFIALAFFLVGALADLFAPNFGVLLAGRVFQAISTGMLMPLMQTIAM
PF07690         yslgyaiasllaGrlsdrfGrrrvlllglllfalglllllfasslwalllvlrvlqGlgagalfpagaal
PF07690         yslgyaiasllaGrlsdrfGrrrvlllglllfalglllllfasslwalllvlrvlqGlgagalfpagaal


                         +         -         -         -         -         *         -:210
query           TRFPRGRQATAMGVAGIAMGFAPNIGPTIGGAMSFSLGWRSFFVLLVVIMLALAAAAAVAIKPSAAPDKS
PF07690         iadwfpkeergralgllsagfslGailgpllggllasslgWravFlilailsllaavlvllllprepper
PF07690         iadwfpkeergralgllsagfslGailgpllggllasslgWravFlilailsllaavlvllllprepper


                         -         -         -         +         -         -         -:280
query           ARLDVVSLAQSTLGFGGLLLAFSNASSFSFESPFIWAPLVLGALFLVLFVRRQKRVDDPLISMDIFSSRQ
PF07690         krkspaeel................................................rkepaplvpawkl
PF07690         krkspaeel................................................rkepaplvpawkl


                         -         *         -         -         -         -         +:350
query           YRAGFIAQNLLNASFMGVTLIVPLYVEGLCGGTALEAGVVLLPGTVAALVLNPLAGVLTDKVGVRPVALV
PF07690         llkpplaaflaalarsilgpalplalaedlgispseigwlltlyslgyaiasllaGrlsdrfGrrrvlll
PF07690         llkpplaaflaalarsilgpalplalaedlgispseigwlltlyslgyaiasllaGrlsdrfGrrrvlll


                         -         -         -         -         *         -         -:420
query           SGAFLATGAVLMSFLDADTPLYVTTLCQAVRAVGVSGLVGPLTSWSLAQLPRPIVADGSSFCISARQACA
PF07690         glllfalglllllf..a.sslwalllvlrvlqGlgagalfpagaaliadwfpke....ergralgllsag
PF07690         glllfalglllllf..a.sslwalllvlrvlqGlgagalfpagaaliadwfpke....ergralgllsag


                         -         -         +         -         -         -         -:490
query           SLGTSVMVFLIAVAGASAAGLANPALAYQLAFGFSAVMAVATLGFIVAKVR-------------------
PF07690         fslGailgpllgglla.sslg.......WravFlilailslla---------------------------
PF07690         fslGailgpllgglla.sslg.......WravFlilailslla---------------------------