[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for elen0:ACV56840.1


[Show Plain Result]

## Summary of Sequence Search
   1::435
  20::224  PF00809 0.0% 52.1951219512195  Pterin binding enzyme 
 275::410  PF01288 0.0% 44.4444444444444  7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase 
  43::176  PF03435 0.0% 20.6896551724138  Saccharopine dehydrogenase 
   1::435


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIWRCATYEFDTRMPIVMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVS
PF00809         -------------------ilnvtedsfsdggkflskekaleqaremveeGAdiiDiGgestrPgagmvs
PF01288         ----------------------------------------------------------------------
PF03435         ------------------------------------------vadrtlekaqalaaka...lglrveaia


                         -         -         *         -         -         -         -:140
query           VDEELARVLPVVRALAQRDVCVSIDTRHAEVARACLEAGAAIVNDVSGFRDPAMVDAVRDSDCGLVVMHM
PF00809         keeelerlvpvlealrkeeekvpiSiDtfkaevaeaAlkagadiindvsglendeemaklaaeygaavVl
PF01288         ----------------------------------------------------------------------
PF03435         ldvsnyea..LeallkegdlvvnlappilsltvlkaCietgvhyvdtsy.....................


                         +         -         -         -         -         *         -:210
query           QGDPSTMQNAPSYDDVVADVREWLRDRAAALEAAGVAHDRICIDPGPGFGKTPSQTLELVRNFQEFVRLG
PF00809         mhmdgkpktmqeeleyevdvveellealeerlealeeaGipperiilDpgigfgkteehnlellktldal
PF01288         ----------------------------------------------------------------------
PF03435         .....................lreavlalkekakea----------------------------------


                         -         -         -         +         -         -         -:280
query           YPVMVAVSRKSFLGWAYGIDEPSARDEVSAAEALMACELGASVVRAHNVAATVAALEGLRPYALIGMGCN
PF00809         rellgapllvggsr--------------------------------------------------------
PF01288         ----------------------------------------------------------------ialGsN
PF03435         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           VPLVASPGEEREGKIAMLNQAITELCSLPDSQIVDISSFYESEPAYYLDQDSFVNAVVLLRTGIPPKELL
PF00809         ----------------------------------------------------------------------
PF01288         ..........lgdreenleealealkekekieilkvSslyeteavgaeeqpdflNavveletelspeell
PF03435         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           GYLHAVENSLGRVREVRNGPRTCDLDILDYQLYVVDADVLTLPHPRLLERDFVVQPLLELLPGHVLANDV
PF00809         ----------------------------------------------------------------------
PF01288         allkkiEkklgRkreerwgpRtlDlDillyekevleeekLtiPhpeileraFvlkplaei----------
PF03435         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           PVSVDGVTVGKSVRL-------------------------------------------------------
PF00809         ----------------------------------------------------------------------
PF01288         ----------------------------------------------------------------------
PF03435         ----------------------------------------------------------------------