[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for elen0:ACV56911.1


[Show Plain Result]

## Summary of Sequence Search
   1::191
  30::152  PF00156 0.0% 25.8620689655172  Phosphoribosyl transferase domain 
   1::191


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MELLEERIRRDGVVKSEGVLKVDSFLNHQLDIDLFDAMGEEFKRLFADAPITKILTIEASGIGIACVVAR
PF00156         -----------------------------ldpedlreagrllaeklreekgkkdvvvGiargGvplatel


                         -         -         *         -         -         -         -:140
query           HFGVPVVFAKKAQSINLDGEMFTTRIESFTHGRVYDVIVSKKFLNADDHVLIIDDFLANGCALNGLIELV
PF00156         araLglpldlvrvrkssap.......assetsrkreaailesrpeedlkgkrvliVDDvlatGgTlraai


                         +         -         -         -         -         *         -:210
query           GEAGATVEGIGIAIEKGFQPGGDDLRERGYRLESLAIVERMDPETGEIAFR-------------------
PF00156         elLkeagakevg----------------------------------------------------------