[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for elen0:ACV56973.1


[Show Plain Result]

## Summary of Sequence Search
   1::219
   7::23   PF00037 0.0% 47.0588235294118  4Fe-4S binding domain 
  73::81   PF00037 0.0% 66.6666666666667  4Fe-4S binding domain 
  90::111  PF00037 0.0% 54.5454545454545  4Fe-4S binding domain 
 122::128  PF00037 0.0% 57.1428571428571  4Fe-4S binding domain 
   1::219


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MANYAIVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIEGGSGTFPDVEMYFLPVQCQHCEN
PF00037         ------videekCigCGaCvevC-----------------------------------------------
PF00037         ------videekCigCGaCvevC-----------------------------------------------
PF00037         ------videekCigCGaCvevC-----------------------------------------------
PF00037         ------videekCigCGaCvevC-----------------------------------------------


                         -         -         *         -         -         -         -:140
query           PECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQEERVVEKCTLCEQRISQGELPQCV
PF00037         --CvevCPvgA--------vvideekCigCGaCvevCPvgA----------ekCigCG------------
PF00037         --CvevCPvgA--------vvideekCigCGaCvevCPvgA----------ekCigCG------------
PF00037         --CvevCPvgA--------vvideekCigCGaCvevCPvgA----------ekCigCG------------
PF00037         --CvevCPvgA--------vvideekCigCGaCvevCPvgA----------ekCigCG------------


                         +         -         -         -         -         *         -:210
query           AQCGARARFFGDLDQGVDNFEGPAHPDSPGCQYEEMTQTRVKLKDYVEPYTENDIHHLADVGNEPKLMYL
PF00037         ----------------------------------------------------------------------
PF00037         ----------------------------------------------------------------------
PF00037         ----------------------------------------------------------------------
PF00037         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           MREGRKWRE-------------------------------------------------------------
PF00037         ----------------------------------------------------------------------
PF00037         ----------------------------------------------------------------------
PF00037         ----------------------------------------------------------------------
PF00037         ----------------------------------------------------------------------