[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for elen0:ACV54068.1


[Show Plain Result]

## Summary of Sequence Search
   1::158
   5::130  2.9e-25 29.8% 0045032 00450321 1/1   ed helix" DNA-binding domain            
   2::134  4.5e-23 33.3% 0051337 00513371 1/1   ed helix" DNA-binding domain            
   2::68   4.8e-06 29.2% 0039384 00393841 1/1   ed helix" DNA-binding domain            
   5::66   0.00056 27.4% 0045968 00459681 1/1   ed helix" DNA-binding domain            
   1::158


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQLKASTDYGMRAILYLAAQGTTCSSKDIAEDMSIPRDYLIQLAQLLRNAGIIEARPGKHGGYRLAKDPA
00450321   1/1  ----kkldyalrillylal.depvsseeiAerlgvspstlrkilslLkkaglvesvrGa.Ggyvlardpe
00513371   1/1  -rlstktdyalrallylalhggepvtseeiAerlgispsylrkilakLrkaglvesvrGk.GGyrLarpp
00393841   1/1  -llmllderlllillllleggepvsveeLaeelgvsrstvrrdlalLeelglvirrrgg..gyrlagd--
00459681   1/1  ----lllderrlkillllledgrlsveeLaeelgvSrstvrrhlkrLeeaGliiesvpgkgyrlll----


                         -         -         *         -         -         -         -:140
query           DTNVLEIMEALDDDAKQSTRAKRDARKGGAMVQEIKQVYDLIEESMDAYLSSLTVQMLLDCARNGDNSRT
00450321   1/1  eitlldvvravegplllvecledpnplcpvglailcvlrevlleaeqallevldsitlad----------
00513371   1/1  eeitlldvvravellgplalvecledllgdclvgdaincvlrdllleaeeallevLdsitLadl------
00393841   1/1  ----------------------------------------------------------------------
00459681   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           FLAERLQEESRRLLDAVK----------------------------------------------------
00450321   1/1  ----------------------------------------------------------------------
00513371   1/1  ----------------------------------------------------------------------
00393841   1/1  ----------------------------------------------------------------------
00459681   1/1  ----------------------------------------------------------------------