[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for elen0:ACV54358.1


[Show Plain Result]

## Summary of Sequence Search
   1::589
  71::588  1.5e-24 22.2% 0039664 00396641 1/1   AD(P)-binding domain                    
 353::528  6.1e-24 32.9% 0042899 00428991 1/1   nate dehydrogenase/fumarate reductase f 
 346::520  7.6e-23 31.0% 0036265 00362651 1/1   nate dehydrogenase/fumarate reductase f 
 345::513    2e-22 33.8% 0036733 00367331 1/1   nate dehydrogenase/fumarate reductase f 
  82::588  5.6e-19 22.9% 0040049 00400491 1/1   AD(P)-binding domain                    
  85::589  5.6e-19 20.6% 0035989 00359891 1/1   AD(P)-binding domain                    
  83::591    6e-18 21.2% 0052032 00520321 1/1   AD(P)-binding domain                    
  65::590  1.1e-17 19.1% 0046446 00464461 1/1   AD(P)-binding domain                    
  70::589  2.6e-16 22.5% 0049003 00490031 1/1   AD(P)-binding domain                    
  83::328  5.1e-16 20.0% 0046128 00461281 1/1   AD(P)-binding domain                    
  84::591  9.7e-16 19.7% 0041341 00413411 1/1   AD(P)-binding domain                    
  84::305  1.6e-15 20.5% 0047682 00476821 1/1   AD(P)-binding domain                    
  70::589  1.8e-15 20.1% 0046270 00462701 1/1   AD(P)-binding domain                    
  86::305  3.6e-15 19.0% 0052926 00529261 1/1   AD(P)-binding domain                    
  66::294    6e-15 24.8% 0049222 00492221 1/1   AD(P)-binding domain                    
  84::588  5.2e-14 22.1% 0048199 00481991 1/1   AD(P)-binding domain                    
  85::548  2.1e-13 20.5% 0047029 00470291 1/1   AD(P)-binding domain                    
  77::352  6.4e-13 25.8% 0052911 00529111 1/1   AD(P)-binding domain                    
  86::306  7.7e-13 21.0% 0048494 00484941 1/1   AD(P)-binding domain                    
  87::294  1.2e-12 22.6% 0046834 00468341 1/1   AD(P)-binding domain                    
  85::298    4e-12 19.5% 0047564 00475641 1/1   AD(P)-binding domain                    
  88::588  6.7e-12 23.3% 0043577 00435771 1/1   AD(P)-binding domain                    
  87::589  7.1e-12 22.9% 0045870 00458701 1/1   AD(P)-binding domain                    
  86::296  7.6e-12 21.7% 0046579 00465791 1/1   AD(P)-binding domain                    
  85::372  8.6e-12 23.3% 0036459 00364591 1/1   otide-binding domain                    
  84::591  1.3e-11 21.7% 0046514 00465141 1/1   AD(P)-binding domain                    
  85::298  1.5e-11 29.6% 0052313 00523131 1/1   AD(P)-binding domain                    
  88::305  2.5e-11 16.1% 0045881 00458811 1/1   AD(P)-binding domain                    
  85::589  3.4e-11 20.3% 0040035 00400351 1/1   AD(P)-binding domain                    
  86::551  6.2e-11 20.6% 0047022 00470221 1/1   AD(P)-binding domain                    
  85::294  7.6e-11 18.1% 0048583 00485831 1/1   AD(P)-binding domain                    
  82::294  1.2e-10 30.2% 0048807 00488071 1/1   otide-binding domain                    
  87::294  2.1e-10 20.6% 0048009 00480091 1/1   AD(P)-binding domain                    
  85::589  2.6e-10 25.3% 0047270 00472701 1/1   AD(P)-binding domain                    
  87::294  2.6e-10 20.6% 0053322 00533221 1/1   AD(P)-binding domain                    
  87::297  2.7e-10 20.8% 0045795 00457951 1/1   otide-binding domain                    
  84::303  3.4e-10 20.4% 0046274 00462741 1/1   AD(P)-binding domain                    
  87::294    4e-10 24.7% 0048866 00488661 1/1   AD(P)-binding domain                    
  83::294  5.2e-10 19.0% 0050363 00503631 1/1   AD(P)-binding domain                    
  86::588  7.2e-10 26.7% 0037643 00376431 1/1   AD(P)-binding domain                    
  85::551  8.1e-10 21.3% 0040660 00406601 1/1   AD(P)-binding domain                    
  88::294  8.1e-10 23.4% 0047271 00472711 1/1   AD(P)-binding domain                    
  84::555  9.5e-10 22.4% 0036300 00363001 1/1   AD(P)-binding domain                    
  67::376  9.8e-10 21.7% 0037441 00374411 1/1   AD(P)-binding domain                    
  83::294  1.1e-09 25.0% 0047141 00471411 1/1   otide-binding domain                    
  85::551  1.2e-09 19.5% 0046760 00467601 1/1   AD(P)-binding domain                    
  88::294  1.2e-09 23.4% 0052963 00529631 1/1   AD(P)-binding domain                    
  82::589  1.5e-09 19.6% 0036092 00360921 1/1   AD(P)-binding domain                    
  82::588  1.9e-09 20.9% 0040688 00406881 1/1   AD(P)-binding domain                    
  88::303    2e-09 21.4% 0048607 00486071 1/1   AD(P)-binding domain                    
  85::292  2.1e-09 21.6% 0036889 00368891 1/1   AD(P)-binding domain                    
  86::588  2.2e-09 22.4% 0053321 00533211 1/1   AD(P)-binding domain                    
  83::294  2.3e-09 17.0% 0038449 00384491 1/1   AD(P)-binding domain                    
  82::294  2.4e-09 22.2% 0048045 00480451 1/1   AD(P)-binding domain                    
  86::298  2.4e-09 23.9% 0047712 00477121 1/1   AD(P)-binding domain                    
  84::299  2.9e-09 19.8% 0048356 00483561 1/1   AD(P)-binding domain                    
  69::293  4.1e-09 17.5% 0044705 00447051 1/1   AD(P)-binding domain                    
  76::294  5.3e-09 28.0% 0038468 00384681 1/1   AD(P)-binding domain                    
  81::352  5.7e-09 18.7% 0049150 00491501 1/1   AD(P)-binding domain                    
  86::581  6.5e-09 22.0% 0045797 00457971 1/1   AD(P)-binding domain                    
  86::294  6.5e-09 21.0% 0048771 00487711 1/1   AD(P)-binding domain                    
  88::294  7.2e-09 20.6% 0049679 00496791 1/1   AD(P)-binding domain                    
  84::591  7.6e-09 23.6% 0045518 00455181 1/1   AD(P)-binding domain                    
  86::300  7.8e-09 18.3% 0044413 00444131 1/1   AD(P)-binding domain                    
  82::387  8.3e-09 23.5% 0050148 00501481 1/1   AD(P)-binding domain                    
  84::575    1e-08 20.5% 0046416 00464161 1/1   AD(P)-binding domain                    
  84::575  1.1e-08 23.0% 0040602 00406021 1/1   AD(P)-binding domain                    
  85::294  1.1e-08 23.2% 0038074 00380741 1/1   AD(P)-binding domain                    
  57::293  1.2e-08 17.1% 0048365 00483651 1/1   AD(P)-binding domain                    
  84::294  1.8e-08 22.0% 0050961 00509611 1/1   AD(P)-binding domain                    
  82::588  2.2e-08 20.8% 0044098 00440981 1/1   AD(P)-binding domain                    
  85::588  2.2e-08 19.3% 0047133 00471331 1/1   AD(P)-binding domain                    
  86::294  2.2e-08 21.7% 0046057 00460571 1/1   otide-binding domain                    
  86::294  2.8e-08 18.8% 0052600 00526001 1/1   AD(P)-binding domain                    
  87::293  1.2e-07 21.4% 0036654 00366541 1/1   AD(P)-binding domain                    
  86::237  1.7e-07 26.5% 0049990 00499901 1/1   otide-binding domain                    
  87::292  2.5e-07 17.2% 0047565 00475651 1/1   AD(P)-binding domain                    
  85::294  2.8e-07 18.8% 0048200 00482001 1/1   AD(P)-binding domain                    
  88::294  2.9e-07 22.3% 0042446 00424461 1/1   AD(P)-binding domain                    
  82::155  3.2e-07 23.4% 0045481 00454811 1/1    N-terminal domain                      
  88::309  3.2e-07 18.0% 0047909 00479091 1/1   )-binding Rossmann-fold domains         
  87::294  3.9e-07 26.9% 0050927 00509271 1/1   AD(P)-binding domain                    
  88::294  8.1e-07 25.6% 0036301 00363011 1/1   AD(P)-binding domain                    
  87::294  8.4e-07 21.6% 0050960 00509601 1/1   AD(P)-binding domain                    
  85::294  1.1e-06 24.5% 0046750 00467501 1/1   AD(P)-binding domain                    
  86::152  1.2e-06 27.7% 0046156 00461561 1/1   otide-binding domain                    
  77::294  1.4e-06 21.8% 0047068 00470681 1/1   AD(P)-binding domain                    
  85::152  3.7e-06 31.8% 0048016 00480161 1/1   otide-binding domain                    
  85::294  5.5e-06 25.6% 0045519 00455191 1/1   AD(P)-binding domain                    
  87::294  5.7e-06 22.1% 0046972 00469721 1/1   AD(P)-binding domain                    
  87::295  7.3e-06 24.5% 0048584 00485841 1/1   AD(P)-binding domain                    
  88::361  7.5e-06 19.0% 0047327 00473271 1/1   otide-binding domain                    
  85::294  8.5e-06 20.0% 0048865 00488651 1/1   AD(P)-binding domain                    
  73::124  4.7e-05 30.8% 0037437 00374371 1/1   )-binding Rossmann-fold domains         
  88::122    7e-05 34.3% 0050364 00503641 1/1   AD(P)-binding domain                    
  88::294  8.6e-05 25.3% 0040619 00406191 1/1   AD(P)-binding domain                    
  87::295  8.9e-05 21.9% 0046761 00467611 1/1   AD(P)-binding domain                    
  88::294  9.4e-05 25.5% 0046973 00469731 1/1   AD(P)-binding domain                    
  88::209  0.00017 20.3% 0052964 00529641 1/1   AD(P)-binding domain                    
  87::294  0.00029 20.0% 0048364 00483641 1/1   AD(P)-binding domain                    
  85::156  0.00032 20.8% 0048108 00481081 1/1   AD(P)-binding domain                    
  88::294  0.00053 19.0% 0036016 00360161 1/1   AD(P)-binding domain                    
  87::115  0.00068 41.4% 0047276 00472761 1/1   )-binding Rossmann-fold domains         
  88::115  0.00072 46.4% 0053383 00533831 1/1   )-binding Rossmann-fold domains         
  88::156  0.00087 20.3% 0038285 00382851 1/1   AD(P)-binding domain                    
  88::292  0.00097 21.5% 0041940 00419401 1/1   AD(P)-binding domain                    
   1::589


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MITKGTAFDRRSFLKGAMLAGAGTAAFGLAGCAANGGGASGGASSNASASSGTAGQLSAEAISKGTWAFE
00396641   1/1  ----------------------------------------------------------------------
00428991   1/1  ----------------------------------------------------------------------
00362651   1/1  ----------------------------------------------------------------------
00367331   1/1  ----------------------------------------------------------------------
00400491   1/1  ----------------------------------------------------------------------
00359891   1/1  ----------------------------------------------------------------------
00520321   1/1  ----------------------------------------------------------------------
00464461   1/1  ----------------------------------------------------------------Mmplsl
00490031   1/1  ---------------------------------------------------------------------l
00461281   1/1  ----------------------------------------------------------------------
00413411   1/1  ----------------------------------------------------------------------
00476821   1/1  ----------------------------------------------------------------------
00462701   1/1  ---------------------------------------------------------------------M
00529261   1/1  ----------------------------------------------------------------------
00492221   1/1  -----------------------------------------------------------------sllad
00481991   1/1  ----------------------------------------------------------------------
00470291   1/1  ----------------------------------------------------------------------
00529111   1/1  ----------------------------------------------------------------------
00484941   1/1  ----------------------------------------------------------------------
00468341   1/1  ----------------------------------------------------------------------
00475641   1/1  ----------------------------------------------------------------------
00435771   1/1  ----------------------------------------------------------------------
00458701   1/1  ----------------------------------------------------------------------
00465791   1/1  ----------------------------------------------------------------------
00364591   1/1  ----------------------------------------------------------------------
00465141   1/1  ----------------------------------------------------------------------
00523131   1/1  ----------------------------------------------------------------------
00458811   1/1  ----------------------------------------------------------------------
00400351   1/1  ----------------------------------------------------------------------
00470221   1/1  ----------------------------------------------------------------------
00485831   1/1  ----------------------------------------------------------------------
00488071   1/1  ----------------------------------------------------------------------
00480091   1/1  ----------------------------------------------------------------------
00472701   1/1  ----------------------------------------------------------------------
00533221   1/1  ----------------------------------------------------------------------
00457951   1/1  ----------------------------------------------------------------------
00462741   1/1  ----------------------------------------------------------------------
00488661   1/1  ----------------------------------------------------------------------
00503631   1/1  ----------------------------------------------------------------------
00376431   1/1  ----------------------------------------------------------------------
00406601   1/1  ----------------------------------------------------------------------
00472711   1/1  ----------------------------------------------------------------------
00363001   1/1  ----------------------------------------------------------------------
00374411   1/1  ------------------------------------------------------------------liid
00471411   1/1  ----------------------------------------------------------------------
00467601   1/1  ----------------------------------------------------------------------
00529631   1/1  ----------------------------------------------------------------------
00360921   1/1  ----------------------------------------------------------------------
00406881   1/1  ----------------------------------------------------------------------
00486071   1/1  ----------------------------------------------------------------------
00368891   1/1  ----------------------------------------------------------------------
00533211   1/1  ----------------------------------------------------------------------
00384491   1/1  ----------------------------------------------------------------------
00480451   1/1  ----------------------------------------------------------------------
00477121   1/1  ----------------------------------------------------------------------
00483561   1/1  ----------------------------------------------------------------------
00447051   1/1  --------------------------------------------------------------------ar
00384681   1/1  ----------------------------------------------------------------------
00491501   1/1  ----------------------------------------------------------------------
00457971   1/1  ----------------------------------------------------------------------
00487711   1/1  ----------------------------------------------------------------------
00496791   1/1  ----------------------------------------------------------------------
00455181   1/1  ----------------------------------------------------------------------
00444131   1/1  ----------------------------------------------------------------------
00501481   1/1  ----------------------------------------------------------------------
00464161   1/1  ----------------------------------------------------------------------
00406021   1/1  ----------------------------------------------------------------------
00380741   1/1  ----------------------------------------------------------------------
00483651   1/1  --------------------------------------------------------ipgldlpgvllllt
00509611   1/1  ----------------------------------------------------------------------
00440981   1/1  ----------------------------------------------------------------------
00471331   1/1  ----------------------------------------------------------------------
00460571   1/1  ----------------------------------------------------------------------
00526001   1/1  ----------------------------------------------------------------------
00366541   1/1  ----------------------------------------------------------------------
00499901   1/1  ----------------------------------------------------------------------
00475651   1/1  ----------------------------------------------------------------------
00482001   1/1  ----------------------------------------------------------------------
00424461   1/1  ----------------------------------------------------------------------
00454811   1/1  ----------------------------------------------------------------------
00479091   1/1  ----------------------------------------------------------------------
00509271   1/1  ----------------------------------------------------------------------
00363011   1/1  ----------------------------------------------------------------------
00509601   1/1  ----------------------------------------------------------------------
00467501   1/1  ----------------------------------------------------------------------
00461561   1/1  ----------------------------------------------------------------------
00470681   1/1  ----------------------------------------------------------------------
00480161   1/1  ----------------------------------------------------------------------
00455191   1/1  ----------------------------------------------------------------------
00469721   1/1  ----------------------------------------------------------------------
00485841   1/1  ----------------------------------------------------------------------
00473271   1/1  ----------------------------------------------------------------------
00488651   1/1  ----------------------------------------------------------------------
00374371   1/1  ----------------------------------------------------------------------
00503641   1/1  ----------------------------------------------------------------------
00406191   1/1  ----------------------------------------------------------------------
00467611   1/1  ----------------------------------------------------------------------
00469731   1/1  ----------------------------------------------------------------------
00529641   1/1  ----------------------------------------------------------------------
00483641   1/1  ----------------------------------------------------------------------
00481081   1/1  ----------------------------------------------------------------------
00360161   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00382851   1/1  ----------------------------------------------------------------------
00419401   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           IAPEPVADSEIAQAYEADIIVVGAGVSGLACAASATEEGADVILFAASSQPVARGGSNHGIGTKFHERLG
00396641   1/1  MsylasaallaalpslletieyDVlviGgGpaGlsaAlelarlapdaGlkValvEkg..dlgggasgrsg
00428991   1/1  ----------------------------------------------------------------------
00362651   1/1  ----------------------------------------------------------------------
00367331   1/1  ----------------------------------------------------------------------
00400491   1/1  -----------MkdleyDvvvvGaGpaGlaaAlalaragpdlkvaliekgplgggasclngggipaklll
00359891   1/1  --------------eeyDvviiGaGpaGlsaAlrLaraG.kVlvlEkgpvlggtsglngggipggllld.
00520321   1/1  ------------MmdeeyDvviiGaGpaGlsaAlrLaraGlkVlvlEkgpllggtsglngggihaglskl
00464461   1/1  llatalelplp.alaldkkyDvvViGaGpaGlaaAlalaraGlkVlllEkgdrl...GGtslta.ggill
00490031   1/1  MlpeslleplpalsaseeydVvViGaGpaGlaaAlalaraGlkVlllEkgprlggtsclnggglppgglr
00461281   1/1  ------------glellllslltemmskeyDvvvvGaGpaGlvaAlrLaedaGlkVlvlEagdrlgGasc
00413411   1/1  -------------MpmsseeyDvvViGaGpaGlaaAlrlaraGlkVlllEkgpvlgGtssrn...qggir
00476821   1/1  -------------lallslllllllglllalpdlamdkeyDvvvvGaGpaGltaAlrLae.GlkVlvlEa
00462701   1/1  MsplllalllllpllllaldeeydvvviGaGpaGlaaAlalaraGlkVlllEkgdrlGGtslrsggilld
00529261   1/1  ---------------lniksielflsiieraldeglvppsmemmmekydvvIiGaGpaGlaaAlrLlqlA
00492221   1/1  talrlpplpplsldeeyDVvvvGAGpaGlaaAyeLarapGlkVlvlEkgdrlGGtsrnggvipdgglldp
00481991   1/1  -------------klllatgslplipplegllldgvlllrtlldalallemlkkeydvvviGgGpaGlaa
00470291   1/1  --------------lllllslsllllllsslllmmskeyDvviiGaGpaGlvaAlrLaelaGlkVlvlEa
00529111   1/1  ------llsnlplgrllpfllptslwldtlplpllellisraileralpdldmdkeyDVvIvGAGpaGLs
00484941   1/1  ---------------aakkydvvIiGaGpaGlaaAlrLaraGlkVtvlEkgdrlGGrsrtggypgfpiid
00468341   1/1  ----------------smasesdydvvIiGaGpaGlsaAlrLaralgklpGlkVtvlEkgprpggrsrgg
00475641   1/1  --------------lldkeyDVvviGgGpaGlaaAlrlaraGlkvlllEkgdrlgGtclnsgcipskall
00435771   1/1  -----------------dVaviGAGiaGlaaAyeLaraGlkVtvlEardrl...GGrsrtvgypgfrldl
00458701   1/1  ----------------ydVvvvGAGiaGlaaAlrLaeaGltdvlvlEagdrv...GGrartvr.......
00465791   1/1  ---------------mkeyDvvIiGaGiaGlsaAlrLakaGlkVlvlEkgdrpGgrgasgrnaggia...
00364591   1/1  --------------mgrvcppcegaclllllagpvailllepaladelllgllplllpamskkkdvvvvG
00465141   1/1  -------------eieydvvViGaGpaGlaaAlrlaraGlkVtviEkgprlggclnvgcipgkaldaaal
00523131   1/1  --------------msydVvvvGAGiaGlsaAlaLarrGlrvlllergdvlggascrnsggglakgllle
00458811   1/1  -----------------llydvvIiGaGpaGlsaAlrLaraGlkVlvlEkGplvnrdrlGGtsnggdgrl
00400351   1/1  --------------MeyDvvvvGaGpaGlaaAlrLaraGlkVlvlErgdrpGGtsltnggpgfkldlgaa
00470221   1/1  ---------------myDVvviGgGiaGlaaAlrLaraGlkVlvlEagdrlGGrlrtvrlgggtsldlgg
00485831   1/1  --------------lsedkeyDVvviGgGpaGlaaAlalaraGlkVlllEkgpelggtclaaggipskal
00488071   1/1  -----------irvcilcelacllllllgpvlilllelaaalllpllllpatkkkdvaviGaGpaGlaaA
00480091   1/1  ----------------ppipglegvltsrdlldllelpkdvvviGgGpaGleaAlalarlgaevtvverg
00472701   1/1  --------------ledllldllsmstkkdvvviGaGpaGleaAlalarlglkvtlierg.....lGgtl
00533221   1/1  ----------------ipgldlegvltsrdlldllelpkdvvviGgGpaGleaAlalarlgaevtvverg
00457951   1/1  ----------------yDVvIiGaGpaGlsaAlrLaraGldlgselkVtvlEkgdrlGGtsglnaglipp
00462741   1/1  -------------mlMkkkyDviiiGaGpaGlaaAleLaraGlkVlvlEkgdrl...GGtwasngipgip
00488661   1/1  ----------------srprvlpipgldlegvlllrtlldsdallellalpkdvvviGgGpaGleaAaal
00503631   1/1  ------------masmsmkydvvIiGaGpaGlaaAlrLaraGlkvtvlEkgprlGgtwrt..........
00376431   1/1  ---------------eydvvvvGaGpaGlaaAlalaraglkvlllekgprlg...gllvglipsklll..
00406601   1/1  --------------MddlpeeyDVvViGaGlaGlaaAaaLaraGlrVlvlEkrdrlGGtsatsrypGfrf
00472711   1/1  -----------------PrlpdipglelflgkgvhtsatldgllfkgkdvvviGgGpaGleaAlalarlg
00363001   1/1  -------------mekydvvviGaGlaGlsaAlelaragldvtvlergprlggcllllsvp.........
00374411   1/1  talllgllpplsaskkydvvviGaGpaGlaaAleLaraGlkVtvlEardrlGGrlrtaripglgasldlg
00471411   1/1  ------------mstkkdvaiiGaGpaGlsaAiyLaraGlddvtvlEkndrlgGrll..ggipgfalpa.
00467601   1/1  --------------MkeyDvvviGaGpaGlaaAlrlarlgldkvlviekgpllggqtllllggtclnvgc
00529631   1/1  -----------------mptkkdVaiIGAGpaGLaaAllLaraGhdldVtvfErrdrpGGlwrttgrigs
00360921   1/1  -----------pplmmdeeydvvViGaGpaGlaaAlrLaraGlkVlvlEr.......gGrlasgripgkl
00406881   1/1  -----------MsskeydvvviGgGpaGlaaAlrlaraGlkvlllekgdrlgglllag.cipgkallaaa
00486071   1/1  -----------------myDvviiGaGpaGlaaAlrLaraGlkVlvlEk.drl...GGtclnvgcipska
00368891   1/1  --------------ppipglellltsddalellelpkdvvviGgGpaGleaAlalarlglkvtliergdr
00533211   1/1  ---------------mekydvviiGaGpaGlaaAlrlaraGlkvlvlEkgprpgglsrlnggggaaldlp
00384491   1/1  ------------lpgvellltsddalaleelpkdvvviGgGpaGleaAlalarlglkvtvver.drlggt
00480451   1/1  -----------pgldlelvltsddlldleelpkdvvviGgGpaGleaAlalarlgakvtlverrdrlggl
00477121   1/1  ---------------ektdVaIvGAGpaGlaaAlaLaraGldvtvlErrdrpggtalgrggalsprglel
00483561   1/1  -------------MskkydvviiGaGiaGlsaAlrLaraGlkVlllEkgdrlGGtsgrnaglipgglrld
00447051   1/1  prllpipgedlflgkgvltsatilgalllfkgkdvvviGgGpaGleaAlylarlgakvtlierrdrlggt
00384681   1/1  -----ftprvlpipgeeacglltadepvailflerlihsyavkdgppftgkdVaViGaGpaGldaAlyla
00491501   1/1  ----------MirvcpalceslvvlaaglepplpplsaskkkdvvviGaGpaGlaaAyrLaraGlkVtvl
00457971   1/1  ---------------sekydvviiGaGpaGlaaAlrlarlaglkvlliekg.rlgglllllayggil...
00487711   1/1  ---------------kydvviiGaGiaGlsaAleLarrGlkdVtvlErgplpggggasgrnagllha...
00496791   1/1  -----------------PgipgleeflgkgvhtsatldglefrgkdvvviGgGpaGleaAlylarlglkv
00455181   1/1  -------------MseydvvviGgGpaGlaaAlrlaeaGlkvlvlEkgdrlgglsnrn............
00444131   1/1  ---------------MsdedyDviviGaGiaGlvaAarLakaGlkVlvlEkgdrlGGtaatlgldglkfd
00501481   1/1  -----------lmeleydvvviGgGpaGlaaAlylaraglkvtliekgplllyalgglllyvgcilskal
00464161   1/1  -------------MleydvvviGgGpaGlaaAlrlaraGlkvlliekgdrlGGtllntgc...ipgkall
00406021   1/1  -------------MseyDvvvvGaGpaGlaaAlrlaraGlkvlllEkgdrlggtsllgggllnagdildk
00380741   1/1  --------------keydvvviGgGpaGlaaAlrlaraGlkvlllekgdlgggclnvgcipgkrllaaae
00483651   1/1  sddalallellllakpkdvvviGgGpaGleaAlalarlGakVtviergdrlggrll..............
00509611   1/1  -------------lPrllpipglegvlllrtlldsdlllellelpkdvvviGgGpaGleaAlalarlglk
00440981   1/1  -----------MeskkydvvviGaGpaGlaaAlylaraglkvtllekgprlggllntgcgpsklllpgal
00471331   1/1  --------------tmkydvviiGaGpaGlaaAlrlaraGlkvlllEkgprlgyktllalGgllltvgli
00460571   1/1  ---------------pmmskkkdvvViGaGiaGlsaAlaLaraGysVtvlErgdrpggtsgtnggllaag
00526001   1/1  ---------------MseeyDvvvvGaGpaGltaAleLaraGlkVlllEagdrvgGtslrngglphkglr
00366541   1/1  ----------------vlpipgldgegvltsrdlldllelpkdvvviGgGpaGleaAaalarlgakvtvv
00499901   1/1  ---------------kkdvvviGAGiaGlaaAlrLaeaGhkVtvlEardriGGrsrtngg..........
00475651   1/1  ----------------pipgldlegvltsrdlldllelpkdvvviGgGpaGleaAlalarlgakvtvver
00482001   1/1  --------------llpipglevltsdgaldllelpkdvvviGgGpaGleaAlalarlglkvtlvergdr
00424461   1/1  -----------------vPrvlpipgidlggvlhaldfldpkalkgkkVaviGaGpaGlaaAlyLarlGa
00454811   1/1  -----------tdlkgkrVvViGaGlsGlaaarlllrlGaevtvldrrdrpggl..........lllelg
00479091   1/1  -----------------mmsylplfldlkgkrVliiGgGpaGltaAlelakaGakvtlverdpr......
00509271   1/1  ----------------vydvviiGaGpaGlaaAlrlaraglklsevlllek.drlggtil..........
00363011   1/1  -----------------ppipgldlegvftlrtlddalalreallagkrvvvvGgGlaGleaAaalrrlg
00509601   1/1  ----------------kdvvviGgGpaGleaAlalar.glkvtliergdrlggtrpllsgvipgkll...
00467501   1/1  --------------kkkdvvvvGgGpaGltaAlrlarlgpdlevtliekgdrlggtpllpgvlggkllae
00461561   1/1  ---------------gkkvaviGaGpaGlaaAllLakalpghdvtvfEkgp..vpggllrygiapdfrlp
00470681   1/1  ------lllllmmmlhydvvviGgGpAGlaaAlrlarldpgarvlliekepglgynrgclpkklllaaae
00480161   1/1  --------------tgkkVavvGaGpAGlaaAaqLaraldlseelghdvtvferl..prpggllrygiap
00455191   1/1  --------------ppipgvellltsddalalkelpkdvvviGgGpaGleaAlalarlgakvtlierrdr
00469721   1/1  ----------------dlpgvellltsddalalkelpkdvvviGgGpaGleaAlalarlgakvtliergd
00485841   1/1  ----------------rPrvppipgldlvltsddlldleelpkdvvviGgGviGleaAlalarlgakvtv
00473271   1/1  -----------------MyDviviGaGiaGlaaAyrLakaGlkVlvlEkgdrlGGraatfrldgfrvdnv
00488651   1/1  --------------mlpkdvviiGgGpaGleaalalarlglklevtliergdrlggtllplgpgpll...
00374371   1/1  --agrlavleaalllervltglgalagllpgkrvlViGaGgiGleaAaalarlG----------------
00503641   1/1  -----------------epklPdipGledFkgelfhsarwphdlvdltgkrV------------------
00406191   1/1  -----------------prvlpipGedlcgvlslrdfvgdynlhpaawllppdltgkrVvviGaGpaGld
00467611   1/1  ----------------gvlllltsddalalkelpkdvvviGgGyiGleaAlalarllpegakvtlvergd
00469731   1/1  -----------------dipglellltsddalalkelpkdvvviGgGyiGleaAaalarlgaevtlverg
00529641   1/1  -----------------rVvViGaGaSgldialelakvaksvtllersdelggpw...............
00483641   1/1  ----------------ydvviiGgGpaGltaaiylarlgpdlkvtliekggtclyvgcllskalg.....
00481081   1/1  --------------aalliliaslglellpadylvlaigssdgaldlpklpkrvvvvGgGyiGlelAaal
00360161   1/1  -----------------prklgiPGedlpgvfsardfvawynglpdaallepdltgkrVvviGgGpaGld
00472761   1/1  ----------------ysrplllgligllgakvlpgkkvaviGaG-------------------------
00533831   1/1  -----------------lellgvallevlgkrilkgkkvaviGaG-------------------------
00382851   1/1  -----------------rvvviGgGliGlelAaalrellpklglevtlveagdrllpryldpelskllle
00419401   1/1  -----------------lPdipglelvltsddalelkepkkvvviGgGyiGleaAsalrrlgaevtlier


                         +         -         -         -         -         *         -:210
query           ITDYTKDTIDGFIRQELARNGYRVDQKKWYKWINNSASTMNWLIDLMEAKGYTTTMEIGYTDTEGVFTAH
00396641   1/1  ggiaaglrllienylgl....dlaellvedlvkggaglvdedlveilatgappavlelegl...gvpflr
00428991   1/1  ----------------------------------------------------------------------
00362651   1/1  ----------------------------------------------------------------------
00367331   1/1  ----------------------------------------------------------------------
00400491   1/1  e........dllerlvvdllkggailvdedlvelldgealeadallla....tGarprlgipgsdlpgvl
00359891   1/1  ......dllerlgedlliglallvdgdlvvvltgegleadallla...tGapprlldipgldelggllsl
00520321   1/1  lldl......rdlleelgvelllggaglvdprgvellgelgleadalllatGrpfdlpipglelfgvrgl
00464461   1/1  dlgarlleglglldlleelleelgielr...........llrdgklvvaltgegleadavllatGarprl
00490031   1/1  ylaglglldlleelaeelgidldflrdgllvlaldgegleadalllatGapprlldipgldllggrvvvi
00461281   1/1  ipsgaglgadlgltllpglfdtll......agldgrdllarrgkvlggsslingmvylrglpedldelak
00413411   1/1  ldlgaipl..dlleelgldlvkggdgltleagalvlatgarpripplpg.lgvpgvltsdgalalrepgk
00476821   1/1  ggrlggrgatpsgggflvdtgadwlfgtepelglegrgillprgkvlGGsslinggvlvrglpedfdalg
00462701   1/1  gglrlleglgll....drleelleelgieldllvdgrlvvaladealeadallla...tGarprllpipg
00529261   1/1  araGpdlkVtvlEkgdrlGGtsrtnggliprgl.................eelldelgipgal.ldagfp
00492221   1/1  elldlleelGlpfdl.......................................................
00481991   1/1  AaylarlGlkvlliekgprlggtclnvgcipskallkaaelaeliellpglgvelllg.glgldlaelle
00470291   1/1  .......GGtarnggyigskpdlgaalfgelldelyelgle...ldgrrllfprgkvlGGsssinggvyl
00529111   1/1  aAyyLakarPglkVlvlEkgdrpGGasgrnggilpsglltdellelleelgipfdpe.............
00484941   1/1  sgallf...............................................pellpyllellkelgle
00468341   1/1  glypgglellrelgledeleelgvdflkalvvlldldlv...............................
00475641   1/1  laalglllllgaalfglllllllllldlvllgaakralgae.............................
00435771   1/1  gaglipgsypyllelleelglelairlntevggavllpdgglltvprdladllaellaladgllleadav
00458701   1/1  ...................ypgfrfd..lgahvflgpggelleylldlleelgleddlrlntevggarll
00465791   1/1  .........................pglgyddrllalakeslellkelgael......gidlfrppgklv
00364591   1/1  aGpaGlaaAlalaraGlkvtllekgdrlggrlllvggipggvlp..........................
00465141   1/1  l.........lrllelleelgvelr.............................lppldglllpgvgdvl
00523131   1/1  elpal.................................................................
00458811   1/1  dlgahvfflllppgllellaelglplglelldlleelleelgidfllgkgvgglsaingvvlergsaedy
00400351   1/1  lllg..pelleelgteaaellaergvrvlrgkglgggstinadavvlatgadprllgipgldydfllpgv
00470221   1/1  ivfpgl.ypallelleelglelallaldg..ellayldglvlelgidlntlvvaldpdalevlledlee.
00485831   1/1  lllalgllllelaallgillllllld............................................
00488071   1/1  lalaraGlkVtllEardrlggrlllsggipgk......................................
00480091   1/1  drlgglld..............................................................
00472701   1/1  lnggpglskpll..........................................................
00533221   1/1  drlgglld..............................................................
00457951   1/1  ............................glggplddrglalaeetlellrelgaelgl.ldglvrpngal
00462741   1/1  sdggaavilgpellellrelgi.elgpkvpeildyllklldkfdllklleflskvngveyiegrasflda
00488661   1/1  arlgakvtlvergdrlggtlld................................................
00503631   1/1  .........grypglllllpallyllldlpllf.....................................
00376431   1/1  ......................................................................
00406601   1/1  dvggsllpgtipgllrllrelgledlellplglagvirgggsvvnalpdeaeallaelgvlfpigyaell
00472711   1/1  lkvtllerrprlggtl......................................................
00363001   1/1  ......................................................................
00374411   1/1  gilfpglsprllellaelgle.aelarllglrvlilldgtvvsldgdldfevlladgeeleadalilatG
00471411   1/1  ......................................................................
00467601   1/1  ipskllllaallpell.elleglgvefdleekgvdldglrlaydklv.......................
00529631   1/1  gldlgpsllrlleelgl..............................ldelleeglsplypglrldvpke
00360921   1/1  ldggahllpglleellaglgdlaellalkpelvalledgaailllprgvrllaglglggssainagvylr
00406881   1/1  lllrllellaelgiellllpypgvdlslv.........................................
00486071   1/1  llyagllpdelelleelglpl.lpgldipvlpgrkgg.................................
00368891   1/1  lgglld................................................................
00533211   1/1  sklllrlldll...................................................lelaella
00384491   1/1  l.....................................................................
00480451   1/1  ld....................................................................
00477121   1/1  leelgll............dallargvpl..dglvvvdgggrlaldfaelalgapgyvvdr.........
00483561   1/1  aall.................................lvrlalesldalreliatgarplglpipgrdlg
00447051   1/1  l.....................................................................
00384681   1/1  rlgakkvtlverrdrlg.....................................................
00491501   1/1  EardrlGGrsrtaglippgflldlgahvfpglaplllelleelglelelltlagaavlalldgklidlpa
00457971   1/1  ......................................................................
00487711   1/1  .....................glayle.....larlaresldllrelveelgid......frrygklvla
00496791   1/1  tlierrdrlggd..........................................................
00455181   1/1  .................gipglrlllgalllrllelleelgipfdlpglgglflprggrvdg........
00444131   1/1  lggsvihgllypallrllrklgldlgpkilhalgelvdlllrtdvsdylefrlldgrvvfpdgkvlkvpt
00501481   1/1  l.....................................................................
00464161   1/1  lgalllellrellelgglflll...pdldlelllelldalv.............................
00406021   1/1  lgllaallvrl............................adalvlatga..rprrlgipglelpggrvvv
00380741   1/1  lyd........elrelleelgipfdevllglllllgrggadg............................
00483651   1/1  ......................................................................
00509611   1/1  Vtliergdrlggld........................................................
00440981   1/1  l.....................................................................
00471331   1/1  pgkallgaall...............................lelaelleelgvevtllellggdrvlpr
00460571   1/1  lvapllllpggipllalale........................................aldllrelgl
00526001   1/1  eladrlielleelgvelllntvvgalltlaellaeydavvlalglglatglagrglavprgrvlggssvi
00366541   1/1  ergdrlggtld...........................................................
00499901   1/1  ................llipglrldlgahlfpgsy.....ellldlleelgvel.....rlntrvv..vd
00475651   1/1  eprlggtld.............................................................
00482001   1/1  lggtl.................................................................
00424461   1/1  evtvierrprl...gg..............................tllalgripakllglealllrlll
00454811   1/1  vefvlgslllellle-------------------------------------------------------
00479091   1/1  ......................................................................
00509271   1/1  ......................................................................
00363011   1/1  levtlvergdrlllpyl.....................................................
00509601   1/1  ......................................................................
00467501   1/1  lllrllel..............................................................
00461561   1/1  kelldrlielle----------------------------------------------------------
00470681   1/1  lldlllelaglgllllvaagdl................................................
00480161   1/1  dfrlpkevvdrl----------------------------------------------------------
00455191   1/1  llgtl.................................................................
00469721   1/1  rllglld...............................................................
00485841   1/1  vergdrllgtld..........................................................
00473271   1/1  gahpfkgl.npelldllkelg....ledkldlrrlvllrgkvlggpsdlngllavrgdedlleakallla
00488651   1/1  ......................................................................
00374371   1/1  ----------------------------------------------------------------------
00503641   1/1  ----------------------------------------------------------------------
00406191   1/1  aArellkdldlllktdisdnaleallarlgaevtvvgRrgpliaaftlkelerlpelggllrygipedkl
00467611   1/1  rllpcld...............................................................
00469731   1/1  drll..pyldcelskall....................................................
00529641   1/1  .................................lgvvillnteveevtgdgvvledgtelleaDavilA-
00483641   1/1  ......................................................................
00481081   1/1  arllpelgaeVtlver------------------------------------------------------
00360161   1/1  aArlllksldellktdindlalealkrlggkeVtvveRrgpleapftlkelrelggl.........lryg
00472761   1/1  ----------------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00382851   1/1  lleelgvelllgtkvt------------------------------------------------------
00419401   1/1  gdrllpll..............................................................


                         -         -         -         +         -         -         -:280
query           PGSHNWVEQADGKESGAATGENLVIAMYEEKIKEQGGQIHYSTIGQYLIREDNNTGRVSAIVAKDPDGNY
00396641   1/1  tsdgaldlkgglvavigggsiarela.................laeaalklgveilegtevtellgdgdg
00428991   1/1  ----------------------------------------------------------------------
00362651   1/1  ----------------------------------------------------------------------
00367331   1/1  ----------------------------------------------------------------------
00400491   1/1  lalgkrvvvvg.......ggviglelaaalaealealpgveillgtevtellgdg...grvtgvvledge
00359891   1/1  dalggrvvvigggviglelaral.....leaaeelpgveillgtevteilgdgdgvtvttgrvtgvvlrd
00520321   1/1  ltlldalkleplllssdlaggllypgkrvvvigggaillealaeaaeel.Gveiltgtevteierdg...
00464461   1/1  lpipgld.llggrvvvigggviglelaralaeaaeel.gveillgtrvteilvde..ggrvtgvttedad
00490031   1/1  gggvdglela............................................................
00461281   1/1  llgvegwgydellpyfkvaedglgltadaiiiatgsrprypgipg.........plsvswaldldelpkr
00413411   1/1  rvvviggglsglel....lvgrgdgaalaralaeaaealgveiltgtevteilrd..eggrvtgVvtadt
00476821   1/1  lgwsyeellpyfkkaekllgvlgalr...........kllvvigggaiglglalvldrlgakvtgvgrld
00462701   1/1  ld.............llgglvvvigggviglelaralaeaaeel.gveillgtrvteilvde..ggrvtg
00529261   1/1  ydgllfvfgg.............gfigledargllrlgagvtvvdrgd............llralaeaae
00492221   1/1  ....................llpgggvvdpaellralaealaeelgveirlgtevtdilrdg...grvtg
00481991   1/1  rkdavv....................................................dgeelaaalael
00470291   1/1  rgskndfdlwaglaglegwsydellpyfkkaekliiatgsrpllpdlpgglllggdgiltselalsl...
00529111   1/1  ..............................................................gpgggtvd
00484941   1/1  lrl.....................pdlggrvvvlpdgkvlgydlglgalpdspealgleefpgrvvvigg
00468341   1/1  ...........lalrllgpdvtggerrpragvvdraellralleaaeelGngrveirlgtrvtsierdge
00475641   1/1  ..........................llrllaelaeklgveillgtavtellkddggvvv..........
00435771   1/1  ilAtGarprlppipgldlkgvltsrdlldllgkrvvviGgGasgldiaealarlgaevtvverrprllal
00458701   1/1  lpdgkllvltsdlnalllelradalilatgalprlppipgldlgevlhsagyeellrrlgldllgkrvvv
00465791   1/1  vaggg.diglllelaealrrlgvpvellspeelkellplldfpeflgglytprggtvdpaelvralleaa
00364591   1/1  ....................................................................ee
00465141   1/1  ....................gaelaaalaealeelgveillgtrvtei.....d.ggvvgvttedg....
00523131   1/1  ...............ggvdrarlaaalaeaaeal.gveirlgtevtdllleg...grvtgVrtadGe...
00458811   1/1  dalipatgaedflgglflpaegilgatgsepfllpgvsllrvldsagalslafrgkrvvvrltyddnyfn
00400351   1/1  hsaedalgldllgkrvvviGggysgvelaealarlgapvtlldrsplarlppgllspgdglldggdgalv
00470221   1/1  ..lradavvlAtGsrprlppipgedlggvlhsallldllgkrvvvigggasgldlaellarlgaevtvvl
00485831   1/1  .........................lllllrrllllllllaagvegllillgvevvvgvadgggvtvvtg
00488071   1/1  ........................................................vdpaellealaela
00480091   1/1  ...........................................eelsllllelleklgvelllgtrvtai
00472701   1/1  ............................lrvlgpelaeylrelleklgveillgtrvtsidrdgd.tgrv
00533221   1/1  ...........................................eelslallelleklgvelllgtrvtai
00457951   1/1  vlaigledadelarl..gkrvavlgggellladgvtgglrpdggrvdparlvrallealeelGveillg.
00462741   1/1  gkwevltedgwgifeeeltadaviiatGarpripdlipglgggvltsddyldledlpgklvdfvllalal
00488661   1/1  .........................................................eelaaallellek
00503631   1/1  ............glpppggggvdraelldylleaaerlgvedvirlgtevtsidfdedgvv....vgvtt
00376431   1/1  ................lrvlgaelaaalaealeelgvevllgtevtsidrdg...ggvtgvllvttgdg.
00406601   1/1  pfyerleklygvlgegylpdlpgasifkglpvhssfddreldldgkrvvvigsgasavrakavviatGar
00472711   1/1  ........................................................dlllelleklgvei
00363001   1/1  ...............ggrldpeelvlalaelleelgvevrlgtevtsidrdgdg......vtledge...
00374411   1/1  arprllpipgfdgkgvltardlldllflgkrvvviGggvsglelaealarllkilgaevtllersdrlla
00471411   1/1  .......................elldalaelaeklgveirlgtev.............dgvtvttedg.
00467601   1/1  .......................daelaaalaelleklgvevllgt.vteiegddgrvtgvvvvrledge
00529631   1/1  lygfpdfplpgwfpvfpgr..................kelldyladlaeklgveirlnteVtsverdgdg
00360921   1/1  vspadfdel......gawgvtlddlepyfelaadalvlatGsrprlpplpglelggvlltaaealgldfl
00406881   1/1  .............plllrvlgaelaaalaealeelgveillgtav...ve.dggr..vtl......dge.
00486071   1/1  .....................greellrylaealeklgveirlgtalfvdpnrVts..............
00368891   1/1  .........................................pelaaallelleklgvevllgtevtaidv
00533211   1/1  rlgaevlrlllglltllergdrllp.......ellrallealeelgveirlgt.vtei......dggvvg
00384491   1/1  ....................................dcilskallelleelgvevllgtevteveldggg
00480451   1/1  .....................................pelaaallelleklgvelllgtrvtaidldggg
00477121   1/1  ..........................aellralleaaeelgveirlgtrvtsileedgdg.....vtvtl
00483561   1/1  glllardaldldalpkrlavlgggllgvdelaellpllgsevtgglrsprggtvdparlvralaeaaeel
00447051   1/1  .........................................dlllelleklgveillgtevteiegdgdg
00384681   1/1  ...............................fpafp.........................elvellkee
00491501   1/1  dvarllaarlvrlldgleleadalilatGarprlllpipgldlfgvlgrvllssdlllgllllgkrvvvi
00457971   1/1  ...................lrvgfiplkrlaelleallelaeklgveillgtevtdidlddd........
00487711   1/1  tgeaelellrelaealralgvdvelldaaelraleplldlpdllgglyvpdggvvdpaalaaalaraaea
00496791   1/1  .................................................pelleyllelleklgveillg
00455181   1/1  .....................aelaaalaeaaeelgveillgtrvt.i......dggvvgvtt...dge.
00444131   1/1  nlaellksfllglsekrrllaflgviatgdrpralgipgldlddlslfellerfllldllpklllilggg
00501481   1/1  ...............llgilgeellarlreqleklgveillgtrvtsidl...dggtv.....vltdg..
00464161   1/1  .........................eelaaalaealeelgveillgtevt.i.....edgrv.gvtled.
00406021   1/1  igggvia....................leeaaeelgveiltgtevtei......dg.vvgvvled..Gee
00380741   1/1  .....................aelaaalaelleelgvevllgtavt.i...ddgr..Vtl......dge.
00483651   1/1  ....................deelalallelleklgvelllgtevteidgdgggv.......vvltdg..
00509611   1/1  ..................................................pelskallelleklgvelll
00440981   1/1  .......................gaelveallelleelgveillgtevtsidldgg.......gv.vltd
00471331   1/1  ldldg..................pellkallealeklgv.illgt..veilgddggv.gvt.....ledG
00460571   1/1  elgidf.......rvgalvlatglaela..dalllalgapprlldapelrellpvvvpgggvvdpaalle
00526001   1/1  ngavylradaidfatgargipgwdldgvlpyfdrledslgvlglpflgkrvvviGggpigvefaealarl
00366541   1/1  ..............................................pelskallelleklgvevllgtev
00499901   1/1  r.dgklvtvpldldgleleadavvlat-------------------------------------------
00475651   1/1  ............................................pelskallelleklgvelllgtevta
00482001   1/1  ........................................dpelsklllelleklgvevllgtevtaieg
00424461   1/1  lllglglll..................................pipgrvlpkellealaealeklgveil
00454811   1/1  ----------------------------------------------------------------------
00479091   1/1  ...................................pelallllelleklgvevllgtrvteiakeylpel
00509271   1/1  ............llggvpsglllgaalllall.elleklgveillgtevtsidld.....ggtvvgvttg
00363011   1/1  ...................................................rpelskallelleelgvel
00509601   1/1  ....................deelaeylrelleklgvevllgtevtsidgdgkg........vtlddg..
00467501   1/1  ..................................................llklgvevllgevtsidpdg
00461561   1/1  ----------------------------------------------------------------------
00470681   1/1  ..............................................daeelvlalaelleelgvevllgt
00480161   1/1  ----------------------------------------------------------------------
00455191   1/1  ........................................dpelskallelleklgvevllgt.......
00469721   1/1  ..........................................pelskallelleklgvelllgtevtaid
00485841   1/1  ...............................................pelsklllelleklgvdlllgtk
00473271   1/1  tg.pylpllpglsleevldsl.lgldllpklvlvigggviglelaellarlgaevtvlergdgllgggdg
00488651   1/1  ...............................glldaeelaeylrelleklgvevllgtevtsidgdgkg.
00374371   1/1  ----------------------------------------------------------------------
00503641   1/1  ----------------------------------------------------------------------
00406191   1/1  lkeflareiadl..........................................................
00467611   1/1  ..........................................pelsklllelleklgvdvllgtevtaid
00469731   1/1  ...................................................elleklgvdlllgtkvtai
00529641   1/1  ----------------------------------------------------------------------
00483641   1/1  .................llglldeelalrllelleklgvelllgtevtsidlegk...tvtllllvlgdg
00481081   1/1  ----------------------------------------------------------------------
00360161   1/1  ippdpldlallelelellpraldrlvellldlllelpdlll.............................
00472761   1/1  ----------------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00382851   1/1  ----------------------------------------------------------------------
00419401   1/1  ...........................................deelsllleelleelgidvllgtevte


                         -         *         -         -         -         -         +:350
query           VKYVGRKAIVLATGDFSANQDMMAKYCSWVAPLLQYNEVDYDAMFQFGGLGPGDGQKMGLWVGAAWQQTL
00396641   1/1  kgrvtgvvtkdlktgevgtiradavvlatGgagnlllllsvlepdlrttnpptnt...............
00428991   1/1  ----------------------------------------------------------------------
00362651   1/1  -----------------------------------------------------------------fvqfh
00367331   1/1  ----------------------------------------------------------------efvQfh
00400491   1/1  tgeevtiradavvlatGgrpnlelll......................tnppgntgdglalleraglel.
00359891   1/1  ladGeevtiradl.vvlatGarsnlllll......................lsgigptgdglalleragl
00520321   1/1  grvtgVtvrdtadGeeetiradl.vvlatGarsnvrllgls......................glglpgd
00464461   1/1  Geeltirada.vvlatGgfpnlalllglglpphPdgrllfgprdddellrllpglgvaliar........
00490031   1/1  .................ralaeaaeelgveillgtrvtellvd..eggrvtgvvledadGeevtira.da
00461281   1/1  lvvigggaiglelapflarlgakvtgvgrlpgllplggvdpsalvaal----------------------
00413411   1/1  kdGeevtirada.vvlatGafsnlrlllglglg......................ltgdglalalrlgap
00476821   1/1  rglptggrgslakallraaerlGve---------------------------------------------
00462701   1/1  vtlrdadGeevtira.davvlatGglsnlrlllglglPifPdgrlllgprpddelrellpglgvalde..
00529261   1/1  elGveirlgteVtsierdedgr..v---------------------------------------------
00492221   1/1  vttedllvdkngve--------------------------------------------------------
00481991   1/1  leelgvevllgtav..ii..ddgtvtv........dge...tieadlvilAtGarprlpplpg.......
00470291   1/1  dllpklvvvigggaiglelapvlarlgakvtgvgrlprglpvgdgglsalvaalakalerlgveiltntr
00529111   1/1  gaalvralaeaaleelgveirlgteVtdilvdg...ggvlwtvrvtGVvvndtgvaldgllkllvdplll
00484941   1/1  gyiglelagkrvrvggakvtllqrrp--------------------------------------------
00468341   1/1  lledleeypvtvtl--------------------------------------------------------
00475641   1/1  tgdgetiradavilAtGa----------------------------------------------------
00435771   1/1  ldalalllgllsldalaalepllalellggllypdg.................gpaalvealaeal.e.g
00458701   1/1  igggasavelaalaragasvtlllrsprlglltprggygalvealakalendylealarlgveirlgtrv
00465791   1/1  eelGveillgtevtsi------------------------------------------------------
00364591   1/1  lvealaelleklgveirlgtrvt.....dg.......vgvttedg...etieadavilAtGarpntllll
00465141   1/1  .etieadavvlAtGars.............................................lllllgrr
00523131   1/1  ..tlradavvlAtGafsr----------------------------------------------------
00458811   1/1  deyqglpereklltlviiGgGn...---------------------------------------------
00400351   1/1  aalaealerlgveillgtrvteilrdg...ggvtgVttedgeleldgeevtirada.vvlatGarssprl
00470221   1/1  errdrlllffppdgqvdpag...............lvralaealeallgveirlgtrvteierdg...gg
00485831   1/1  dg...etiradavi--------------------------------------------------------
00488071   1/1  eelgveirlgtrv.--------------------------------------------------------
00480091   1/1  dvdgdg......vt--------------------------------------------------------
00472701   1/1  tgvtledg.....etleadavvlAtGars.........................................
00533221   1/1  dvdgdg......vt--------------------------------------------------------
00457951   1/1  evteierdg........-----------------------------------------------------
00462741   1/1  aiaviGggasglelasalarlga-----------------------------------------------
00488661   1/1  lgvevllgtrvtai--------------------------------------------------------
00503631   1/1  edG...etieadav--------------------------------------------------------
00376431   1/1  ..etiradavvlAtGar.....................................................
00406601   1/1  eralpapgldllgrspagalpllsrrflvdllpklllaggglvnlllasdstrylefkalpkslviiggg
00472711   1/1  llgtevteidgdg.--------------------------------------------------------
00363001   1/1  ..tleadavvlAtGarprvlll................................................
00374411   1/1  llddegqvd..............................................prglldalaealeel
00471411   1/1  ..etieadavvlAt--------------------------------------------------------
00467601   1/1  .....tleadlvilatGglsllll..............................................
00529631   1/1  ...vt.vttedgep--------------------------------------------------------
00360921   1/1  gkrvvvigggasgvelasalarlgagvtvvyrpdgg.......rgalaralaraaeaagvtvltgtrvte
00406881   1/1  ..tieadlvvlAtGarsllll.................................................
00486071   1/1  vtvttedGetgelvpgetira..-----------------------------------------------
00368891   1/1  dgdg...vtvtl----------------------------------------------------------
00533211   1/1  vtled...GeeetleadlvvlatG..svvrlllg....................................
00384491   1/1  vvvvlgltvevvvl--------------------------------------------------------
00480451   1/1  ......vtvtledg--------------------------------------------------------
00477121   1/1  edggeeetieadlvvgAd----------------------------------------------------
00483561   1/1  Gveillgtevtsierdgg.---------------------------------------------------
00447051   1/1  .ftvtlvrllnlv---------------------------------------------------------
00384681   1/1  gveillgtavleil--------------------------------------------------------
00491501   1/1  GggaiglelalalarlgaevtlversprlgpvlpaglsealaealeallGveirlgtrvteierdg...g
00457971   1/1  vvvvltdgetitltadavvlAtGsrprllpipg.....................................
00487711   1/1  lGveirlgtevtgi--------------------------------------------------------
00496791   1/1  tevteiegdg...d--------------------------------------------------------
00455181   1/1  ..tiradavilAtGalslplll................................................
00444131   1/1  liglepaelsarlglkvtvl--------------------------------------------------
00501481   1/1  .etieadavilAtG........................................................
00464161   1/1  ..geeltleadlvilatGrrsl.............P..................................
00406021   1/1  ltieadl.vvlatGarsnlrl.................................................
00380741   1/1  ..titadavilAtG--------------------------------------------------------
00483651   1/1  .etleadlvvlAt---------------------------------------------------------
00509611   1/1  gtevteidgd....--------------------------------------------------------
00440981   1/1  ge...tieadavvlAtGarprllglpgldlpggl....................................
00471331   1/1  e.eetieadlvvlAtGglsrvrlll.............................................
00460571   1/1  alaeaaeelGveir--------------------------------------------------------
00526001   1/1  gakvtlvergglll--------------------------------------------------------
00366541   1/1  taidv.dgdgvtv---------------------------------------------------------
00499901   1/1  ----------------------------------------------------------------------
00475651   1/1  idgdgdgvvvvl----------------------------------------------------------
00482001   1/1  dgdgvv.vvvklvt--------------------------------------------------------
00424461   1/1  lgtevtsidrdggg--------------------------------------------------------
00454811   1/1  ----------------------------------------------------------------------
00479091   1/1  llgveveagdgvvtvvlgdgetieadlvi-----------------------------------------
00509271   1/1  dgetltad.....v--------------------------------------------------------
00363011   1/1  rlgtevtsidrdg.--------------------------------------------------------
00509601   1/1  .e.leadavvlatG--------------------------------------------------------
00467501   1/1  ktvtledgetleyd--------------------------------------------------------
00461561   1/1  ----------------------------------------------------------------------
00470681   1/1  rvtgidpdg.....--------------------------------------------------------
00480161   1/1  ----------------------------------------------------------------------
00455191   1/1  ......evteidg.--------------------------------------------------------
00469721   1/1  ldgdg.....vtvv--------------------------------------------------------
00485841   1/1  vtaidrdg...dgvt-------------------------------------------------------
00473271   1/1  qiyprgg.agallealak.gveirlntevtri..e...............dGetiea...daVilaaGai
00488651   1/1  .......vtledg.--------------------------------------------------------
00374371   1/1  ----------------------------------------------------------------------
00503641   1/1  ----------------------------------------------------------------------
00406191   1/1  ..............--------------------------------------------------------
00467611   1/1  vddkt.....vtvvt-------------------------------------------------------
00469731   1/1  drdddg.....vlv--------------------------------------------------------
00529641   1/1  ----------------------------------------------------------------------
00483641   1/1  ...etleydklvlA--------------------------------------------------------
00481081   1/1  ----------------------------------------------------------------------
00360161   1/1  ..............--------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00382851   1/1  ----------------------------------------------------------------------
00419401   1/1  iekdgdgvlv..----------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           PNAPMIDAVGPMPYRQSIADFSGLLLNKKGERYSNEDVIFSYGTYAMMMQPDMTRYGIWDTAYANWFDTW
00396641   1/1  ..gdglalalraglelaglelfvqfhptglitepvrg.................................
00428991   1/1  --hPtglvdpgflisealrgeggilvnkdGeRFvnElaprdvvarailaqpgapaylifdsvyldlyhlg
00362651   1/1  Ptglvdpg...flitealrgeggilvnrdGeRFvnElaprdvvarailaqpggpaylifdeavldvy...
00367331   1/1  Ptglvppg...flitealrgeggilvnrdGeRFvnElaprdvvarailaqpggpaylildekvldrl...
00400491   1/1  ......................................................................
00359891   1/1  elvde.................................................................
00520321   1/1  gyalairvgeplpdhl......................................................
00464461   1/1  ......................................................................
00490031   1/1  vvlatGgfpnlrrllgldlpllpvrgtalalgatgdglallerag.....velddrgfvqffPtll....
00461281   1/1  ----------------------------------------------------------------------
00413411   1/1  lpd.......ggflqfhPt...................................................
00476821   1/1  ----------------------------------------------------------------------
00462701   1/1  ......................................................................
00529261   1/1  ----------------------------------------------------------------------
00492221   1/1  ----------------------------------------------------------------------
00481991   1/1  ......................................................................
00470291   1/1  vtrilvdggggglrvtgVetedgggeektiradkeVilaaGaigsprlllls..................
00529111   1/1  lk--------------------------------------------------------------------
00484941   1/1  ----------------------------------------------------------------------
00468341   1/1  ----------------------------------------------------------------------
00475641   1/1  ----------------------------------------------------------------------
00435771   1/1  veillgtrvteierdg...ggvt.vttedadgslkpvledgetiea...davvlatGars.larllld..
00458701   1/1  teilrdg...ggvt.vtta..dGe...tieadavvlatgarplaellgllgpe..........lpergii
00465791   1/1  ----------------------------------------------------------------------
00364591   1/1  ......................------------------------------------------------
00465141   1/1  pntellglegaglelder....................................................
00523131   1/1  ----------------------------------------------------------------------
00458811   1/1  ----------------------------------------------------------------------
00400351   1/1  llls.......................gigpaellkalgielpldlpgvgenlidhptgglla.......
00470221   1/1  vt.Vtt..adGe...tieadlvvlatGarsllrllglpglgleldpa............gerlpdg....
00485831   1/1  ----------------------------------------------------------------------
00488071   1/1  ----------------------------------------------------------------------
00480091   1/1  ----------------------------------------------------------------------
00472701   1/1  ......................................................................
00533221   1/1  ----------------------------------------------------------------------
00457951   1/1  ----------------------------------------------------------------------
00462741   1/1  ----------------------------------------------------------------------
00488661   1/1  ----------------------------------------------------------------------
00503631   1/1  ----------------------------------------------------------------------
00376431   1/1  ......................................................................
00406601   1/1  vigvpatraeifsskllslaekrrlmkflgrlleyeelpelvldldlrelaellrrlgldvtliellerl
00472711   1/1  ----------------------------------------------------------------------
00363001   1/1  ......................................................................
00374411   1/1  lgveirlgtrvteierdg...ggvt.--------------------------------------------
00471411   1/1  ----------------------------------------------------------------------
00467601   1/1  ......................................................................
00529631   1/1  ----------------------------------------------------------------------
00360921   1/1  ierdggg.grvtgVtledgegltgeevtiradl.vvlaaGarsttrllllsglgl..........plppd
00406881   1/1  ......................................................................
00486071   1/1  ----------------------------------------------------------------------
00368891   1/1  ----------------------------------------------------------------------
00533211   1/1  ......................................................................
00384491   1/1  ----------------------------------------------------------------------
00480451   1/1  ----------------------------------------------------------------------
00477121   1/1  ----------------------------------------------------------------------
00483561   1/1  ----------------------------------------------------------------------
00447051   1/1  ----------------------------------------------------------------------
00384681   1/1  ----------------------------------------------------------------------
00491501   1/1  gv--------------------------------------------------------------------
00457971   1/1  ..............ldlegvltsptsildalall....lellpgklvviggGai................
00487711   1/1  ----------------------------------------------------------------------
00496791   1/1  ----------------------------------------------------------------------
00455181   1/1  ......................................................................
00444131   1/1  ----------------------------------------------------------------------
00501481   1/1  ....vlvaigrrpntellkl..glelderggivvdel---------------------------------
00464161   1/1  ......................................................................
00406021   1/1  ......................................................................
00380741   1/1  ----------------------------------------------------------------------
00483651   1/1  ----------------------------------------------------------------------
00509611   1/1  ----------------------------------------------------------------------
00440981   1/1  ......................................................................
00471331   1/1  ......................................................................
00460571   1/1  ----------------------------------------------------------------------
00526001   1/1  ----------------------------------------------------------------------
00366541   1/1  ----------------------------------------------------------------------
00499901   1/1  ----------------------------------------------------------------------
00475651   1/1  ----------------------------------------------------------------------
00482001   1/1  ----------------------------------------------------------------------
00424461   1/1  ----------------------------------------------------------------------
00454811   1/1  ----------------------------------------------------------------------
00479091   1/1  ----------------------------------------------------------------------
00509271   1/1  ----------------------------------------------------------------------
00363011   1/1  ----------------------------------------------------------------------
00509601   1/1  ----------------------------------------------------------------------
00467501   1/1  ----------------------------------------------------------------------
00461561   1/1  ----------------------------------------------------------------------
00470681   1/1  ----------------------------------------------------------------------
00480161   1/1  ----------------------------------------------------------------------
00455191   1/1  ----------------------------------------------------------------------
00469721   1/1  ----------------------------------------------------------------------
00485841   1/1  ----------------------------------------------------------------------
00473271   1/1  psprllglsgi-----------------------------------------------------------
00488651   1/1  ----------------------------------------------------------------------
00374371   1/1  ----------------------------------------------------------------------
00503641   1/1  ----------------------------------------------------------------------
00406191   1/1  ----------------------------------------------------------------------
00467611   1/1  ----------------------------------------------------------------------
00469731   1/1  ----------------------------------------------------------------------
00529641   1/1  ----------------------------------------------------------------------
00483641   1/1  ----------------------------------------------------------------------
00481081   1/1  ----------------------------------------------------------------------
00360161   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00382851   1/1  ----------------------------------------------------------------------
00419401   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           ETFGTTIVENEGKNATTPEGYLASWDSNVEKGTFVKGDTIEEVIAQLDGLDPENAKKSVERYNELCEAKY
00396641   1/1  ......................................................................
00428991   1/1  .........................eellrlgllvkadtleelakkl.gidpaallatverynaaaakgk
00362651   1/1  ......................ldlehllaegllvkadtleelakkl.gidaealaatverynaaaakgv
00367331   1/1  ......................lllehllekgllvkadtleelakkl.gidaeaLaatveryneaaakgk
00400491   1/1  ......................................................................
00359891   1/1  ......................................................................
00520321   1/1  ......................................................................
00464461   1/1  ......................................................................
00490031   1/1  ......................................................................
00461281   1/1  ----------------------------------------------------------------------
00413411   1/1  ......................................................................
00476821   1/1  ----------------------------------------------------------------------
00462701   1/1  ......................................................................
00529261   1/1  ----------------------------------------------------------------------
00492221   1/1  ----------------------------------------------------------------------
00481991   1/1  ......................................................................
00470291   1/1  ...........giglklllkalgipvvvdlp....vg.................................
00529111   1/1  ----------------------------------------------------------------------
00484941   1/1  ----------------------------------------------------------------------
00468341   1/1  ----------------------------------------------------------------------
00475641   1/1  ----------------------------------------------------------------------
00435771   1/1  ......................................................................
00458701   1/1  avdglpvgsllkvhlgfdepf....P............................................
00465791   1/1  ----------------------------------------------------------------------
00364591   1/1  ----------------------------------------------------------------------
00465141   1/1  ......................................................................
00523131   1/1  ----------------------------------------------------------------------
00458811   1/1  ----------------------------------------------------------------------
00400351   1/1  ......................................................................
00470221   1/1  ...W..................................................................
00485831   1/1  ----------------------------------------------------------------------
00488071   1/1  ----------------------------------------------------------------------
00480091   1/1  ----------------------------------------------------------------------
00472701   1/1  ......................................................................
00533221   1/1  ----------------------------------------------------------------------
00457951   1/1  ----------------------------------------------------------------------
00462741   1/1  ----------------------------------------------------------------------
00488661   1/1  ----------------------------------------------------------------------
00503631   1/1  ----------------------------------------------------------------------
00376431   1/1  ......................................................................
00406601   1/1  lagldagplsapsaaialrlflgslgrygnggclypvgglgalvqalaraaeaaGvtillgteVtrilvd
00472711   1/1  ----------------------------------------------------------------------
00363001   1/1  ......................................................................
00374411   1/1  ----------------------------------------------------------------------
00471411   1/1  ----------------------------------------------------------------------
00467601   1/1  ......................................................................
00529631   1/1  ----------------------------------------------------------------------
00360921   1/1  lgvvgrnp..............................................................
00406881   1/1  ......................................................................
00486071   1/1  ----------------------------------------------------------------------
00368891   1/1  ----------------------------------------------------------------------
00533211   1/1  ......................................................................
00384491   1/1  ----------------------------------------------------------------------
00480451   1/1  ----------------------------------------------------------------------
00477121   1/1  ----------------------------------------------------------------------
00483561   1/1  ----------------------------------------------------------------------
00447051   1/1  ----------------------------------------------------------------------
00384681   1/1  ----------------------------------------------------------------------
00491501   1/1  ----------------------------------------------------------------------
00457971   1/1  ......................................................................
00487711   1/1  ----------------------------------------------------------------------
00496791   1/1  ----------------------------------------------------------------------
00455181   1/1  ......................................................................
00444131   1/1  ----------------------------------------------------------------------
00501481   1/1  ----------------------------------------------------------------------
00464161   1/1  .............................................lllpntellgleklgvelder....
00406021   1/1  ......................................................................
00380741   1/1  ----------------------------------------------------------------------
00483651   1/1  ----------------------------------------------------------------------
00509611   1/1  ----------------------------------------------------------------------
00440981   1/1  ......................................................................
00471331   1/1  ......................................................................
00460571   1/1  ----------------------------------------------------------------------
00526001   1/1  ----------------------------------------------------------------------
00366541   1/1  ----------------------------------------------------------------------
00499901   1/1  ----------------------------------------------------------------------
00475651   1/1  ----------------------------------------------------------------------
00482001   1/1  ----------------------------------------------------------------------
00424461   1/1  ----------------------------------------------------------------------
00454811   1/1  ----------------------------------------------------------------------
00479091   1/1  ----------------------------------------------------------------------
00509271   1/1  ----------------------------------------------------------------------
00363011   1/1  ----------------------------------------------------------------------
00509601   1/1  ----------------------------------------------------------------------
00467501   1/1  ----------------------------------------------------------------------
00461561   1/1  ----------------------------------------------------------------------
00470681   1/1  ----------------------------------------------------------------------
00480161   1/1  ----------------------------------------------------------------------
00455191   1/1  ----------------------------------------------------------------------
00469721   1/1  ----------------------------------------------------------------------
00485841   1/1  ----------------------------------------------------------------------
00473271   1/1  ----------------------------------------------------------------------
00488651   1/1  ----------------------------------------------------------------------
00374371   1/1  ----------------------------------------------------------------------
00503641   1/1  ----------------------------------------------------------------------
00406191   1/1  ----------------------------------------------------------------------
00467611   1/1  ----------------------------------------------------------------------
00469731   1/1  ----------------------------------------------------------------------
00529641   1/1  ----------------------------------------------------------------------
00483641   1/1  ----------------------------------------------------------------------
00481081   1/1  ----------------------------------------------------------------------
00360161   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00382851   1/1  ----------------------------------------------------------------------
00419401   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           DDDFHKSATLLAPIKEGPFYGCKLEMSPANFLCVTGGLRTNENMQVCDEQNEPIEGLYNLGIMVGDSYAN
00396641   1/1  ...............................................................givvden
00428991   1/1  dddfgrnp.llapllkgPfyaipvtpa...ahytmgGl--------------------------------
00362651   1/1  ddefgrnp.llapilkgpfyaipvtpaahy----------------------------------------
00367331   1/1  dddfgr.gpllapleepPfyaip-----------------------------------------------
00400491   1/1  ..................................hdtrggivvdetlrt......svpglyaaGdvagtp
00359891   1/1  ........................................rggivvdeglrt......svpglyaaGdaa
00520321   1/1  ..................................................pggivvdetlrts......v
00464461   1/1  ............................................................ytaggipvdp
00490031   1/1  ......................................................................
00461281   1/1  ----------------------------------------------------------------------
00413411   1/1  ....................................hytmggivvdpdlr......tsvpglyaaG...d
00476821   1/1  ----------------------------------------------------------------------
00462701   1/1  ..................................................................hywa
00529261   1/1  ----------------------------------------------------------------------
00492221   1/1  ----------------------------------------------------------------------
00481991   1/1  ................................................grrpnte.lleaagleldergg
00470291   1/1  ..........................................................------------
00529111   1/1  ----------------------------------------------------------------------
00484941   1/1  ----------------------------------------------------------------------
00468341   1/1  ----------------------------------------------------------------------
00475641   1/1  ----------------------------------------------------------------------
00435771   1/1  ......................................................................
00458701   1/1  ......................................................................
00465791   1/1  ----------------------------------------------------------------------
00364591   1/1  ----------------------------------------------------------------------
00465141   1/1  .....................................ggivvdetlrt......svpglyaaGdaag...
00523131   1/1  ----------------------------------------------------------------------
00458811   1/1  ----------------------------------------------------------------------
00400351   1/1  ......................................................................
00470221   1/1  .............................................................---------
00485831   1/1  ----------------------------------------------------------------------
00488071   1/1  ----------------------------------------------------------------------
00480091   1/1  ----------------------------------------------------------------------
00472701   1/1  ...............................npnilglegagllderggivvdetlr......tsvpgvf
00533221   1/1  ----------------------------------------------------------------------
00457951   1/1  ----------------------------------------------------------------------
00462741   1/1  ----------------------------------------------------------------------
00488661   1/1  ----------------------------------------------------------------------
00503631   1/1  ----------------------------------------------------------------------
00376431   1/1  .............pntp.lleglglelderggivvdetlrtsvp............glyaaGdaaggvnp
00406601   1/1  ggg.vrvtGVrla..dGe..tirAda.VvlatGafst...llpslg...............---------
00472711   1/1  ----------------------------------------------------------------------
00363001   1/1  .....................pglellegagleldggivvdeylrt......svpgvyaaGdvag-----
00374411   1/1  ----------------------------------------------------------------------
00471411   1/1  ----------------------------------------------------------------------
00467601   1/1  ...........lgrrpntellgleaaglelderggivvdetlrt............svpgi---------
00529631   1/1  ----------------------------------------------------------------------
00360921   1/1  ......................................................................
00406881   1/1  ..............grrpntellllelagleld.rggivvdetlrt......svpgvyaaGdaag.....
00486071   1/1  ----------------------------------------------------------------------
00368891   1/1  ----------------------------------------------------------------------
00533211   1/1  ....................vrpnlegllleglglelderggivvdetlrts............vpgvya
00384491   1/1  ----------------------------------------------------------------------
00480451   1/1  ----------------------------------------------------------------------
00477121   1/1  ----------------------------------------------------------------------
00483561   1/1  ----------------------------------------------------------------------
00447051   1/1  ----------------------------------------------------------------------
00384681   1/1  ----------------------------------------------------------------------
00491501   1/1  ----------------------------------------------------------------------
00457971   1/1  ..................vllaigrrpntellglegagleld..rggivvdetlr......tsvpgiyaa
00487711   1/1  ----------------------------------------------------------------------
00496791   1/1  ----------------------------------------------------------------------
00455181   1/1  .........glspntpgllleglgielderggivvdenlrt............svpglyaaGdvag....
00444131   1/1  ----------------------------------------------------------------------
00501481   1/1  ----------------------------------------------------------------------
00464161   1/1  .......................................ggilvdetlrt......svpglyaaGdvagg
00406021   1/1  ........llgldlpkelleglgleldtrggivvdetlrt............svpglyaaGdaagp.gqg
00380741   1/1  ----------------------------------------------------------------------
00483651   1/1  ----------------------------------------------------------------------
00509611   1/1  ----------------------------------------------------------------------
00440981   1/1  ............................ealglelderggivvdetlrt......svpglyaaGdvaggp
00471331   1/1  ...........................vrpntellglealgleldierggilvdetlr......tsvpgv
00460571   1/1  ----------------------------------------------------------------------
00526001   1/1  ----------------------------------------------------------------------
00366541   1/1  ----------------------------------------------------------------------
00499901   1/1  ----------------------------------------------------------------------
00475651   1/1  ----------------------------------------------------------------------
00482001   1/1  ----------------------------------------------------------------------
00424461   1/1  ----------------------------------------------------------------------
00454811   1/1  ----------------------------------------------------------------------
00479091   1/1  ----------------------------------------------------------------------
00509271   1/1  ----------------------------------------------------------------------
00363011   1/1  ----------------------------------------------------------------------
00509601   1/1  ----------------------------------------------------------------------
00467501   1/1  ----------------------------------------------------------------------
00461561   1/1  ----------------------------------------------------------------------
00470681   1/1  ----------------------------------------------------------------------
00480161   1/1  ----------------------------------------------------------------------
00455191   1/1  ----------------------------------------------------------------------
00469721   1/1  ----------------------------------------------------------------------
00485841   1/1  ----------------------------------------------------------------------
00473271   1/1  ----------------------------------------------------------------------
00488651   1/1  ----------------------------------------------------------------------
00374371   1/1  ----------------------------------------------------------------------
00503641   1/1  ----------------------------------------------------------------------
00406191   1/1  ----------------------------------------------------------------------
00467611   1/1  ----------------------------------------------------------------------
00469731   1/1  ----------------------------------------------------------------------
00529641   1/1  ----------------------------------------------------------------------
00483641   1/1  ----------------------------------------------------------------------
00481081   1/1  ----------------------------------------------------------------------
00360161   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00382851   1/1  ----------------------------------------------------------------------
00419401   1/1  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           CYNFAICGHNLGMNCNTFAYMLGKDLAEA-----------------------------------------
00396641   1/1  get......svpgly....aaGdva...------------------------------------------
00428991   1/1  ----------------------------------------------------------------------
00362651   1/1  ----------------------------------------------------------------------
00367331   1/1  ----------------------------------------------------------------------
00400491   1/1  lhgag...rlggnglataaasGrlaaea------------------------------------------
00359891   1/1  ...gpglplagglggnglltalasGrlaa-----------------------------------------
00520321   1/1  pglyaaGdaaggsghgan...plggnglata---------------------------------------
00464461   1/1  dgrpllgrltsvpgly....aaGdaaggvh----------------------------------------
00490031   1/1  ............................g-----------------------------------------
00461281   1/1  ----------------------------------------------------------------------
00413411   1/1  aagpglhganplggnglalalasGrlaaeai---------------------------------------
00476821   1/1  ----------------------------------------------------------------------
00462701   1/1  ggipvdpdgrplrgllrtsvpglyaaGda-----------------------------------------
00529261   1/1  ----------------------------------------------------------------------
00492221   1/1  ----------------------------------------------------------------------
00481991   1/1  ivvdetlrt............svpgiya------------------------------------------
00470291   1/1  ----------------------------------------------------------------------
00529111   1/1  ----------------------------------------------------------------------
00484941   1/1  ----------------------------------------------------------------------
00468341   1/1  ----------------------------------------------------------------------
00475641   1/1  ----------------------------------------------------------------------
00435771   1/1  ............................------------------------------------------
00458701   1/1  .............................-----------------------------------------
00465791   1/1  ----------------------------------------------------------------------
00364591   1/1  ----------------------------------------------------------------------
00465141   1/1  .........ggglvatAiasGrlaaeaiagy---------------------------------------
00523131   1/1  ----------------------------------------------------------------------
00458811   1/1  ----------------------------------------------------------------------
00400351   1/1  ................rmgtpdggivvdp-----------------------------------------
00470221   1/1  ----------------------------------------------------------------------
00485831   1/1  ----------------------------------------------------------------------
00488071   1/1  ----------------------------------------------------------------------
00480091   1/1  ----------------------------------------------------------------------
00472701   1/1  aaGdvaggp....lglavvAiaeGrvaal-----------------------------------------
00533221   1/1  ----------------------------------------------------------------------
00457951   1/1  ----------------------------------------------------------------------
00462741   1/1  ----------------------------------------------------------------------
00488661   1/1  ----------------------------------------------------------------------
00503631   1/1  ----------------------------------------------------------------------
00376431   1/1  ...........lagvAlasGrlaalnia------------------------------------------
00406601   1/1  ----------------------------------------------------------------------
00472711   1/1  ----------------------------------------------------------------------
00363001   1/1  ----------------------------------------------------------------------
00374411   1/1  ----------------------------------------------------------------------
00471411   1/1  ----------------------------------------------------------------------
00467601   1/1  ----------------------------------------------------------------------
00529631   1/1  ----------------------------------------------------------------------
00360921   1/1  .............................-----------------------------------------
00406881   1/1  .......ggrgaavAiasGrlaaeaiag------------------------------------------
00486071   1/1  ----------------------------------------------------------------------
00368891   1/1  ----------------------------------------------------------------------
00533211   1/1  aGdaa.....ggpklavvAlasGrvaae------------------------------------------
00384491   1/1  ----------------------------------------------------------------------
00480451   1/1  ----------------------------------------------------------------------
00477121   1/1  ----------------------------------------------------------------------
00483561   1/1  ----------------------------------------------------------------------
00447051   1/1  ----------------------------------------------------------------------
00384681   1/1  ----------------------------------------------------------------------
00491501   1/1  ----------------------------------------------------------------------
00457971   1/1  Gdvag.gpklavvAlaeGrva-------------------------------------------------
00487711   1/1  ----------------------------------------------------------------------
00496791   1/1  ----------------------------------------------------------------------
00455181   1/1  ........ggngvavaiasGrlaaeaiagyl---------------------------------------
00444131   1/1  ----------------------------------------------------------------------
00501481   1/1  ----------------------------------------------------------------------
00464161   1/1  .grlavvaiaeGrla-------------------------------------------------------
00406021   1/1  vatalasGrlaaeai-------------------------------------------------------
00380741   1/1  ----------------------------------------------------------------------
00483651   1/1  ----------------------------------------------------------------------
00509611   1/1  ----------------------------------------------------------------------
00440981   1/1  gp...........lavtAlasGrlaaln------------------------------------------
00471331   1/1  f....aaGdavhgapplavvAlaeGrla------------------------------------------
00460571   1/1  ----------------------------------------------------------------------
00526001   1/1  ----------------------------------------------------------------------
00366541   1/1  ----------------------------------------------------------------------
00499901   1/1  ----------------------------------------------------------------------
00475651   1/1  ----------------------------------------------------------------------
00482001   1/1  ----------------------------------------------------------------------
00424461   1/1  ----------------------------------------------------------------------
00454811   1/1  ----------------------------------------------------------------------
00479091   1/1  ----------------------------------------------------------------------
00509271   1/1  ----------------------------------------------------------------------
00363011   1/1  ----------------------------------------------------------------------
00509601   1/1  ----------------------------------------------------------------------
00467501   1/1  ----------------------------------------------------------------------
00461561   1/1  ----------------------------------------------------------------------
00470681   1/1  ----------------------------------------------------------------------
00480161   1/1  ----------------------------------------------------------------------
00455191   1/1  ----------------------------------------------------------------------
00469721   1/1  ----------------------------------------------------------------------
00485841   1/1  ----------------------------------------------------------------------
00473271   1/1  ----------------------------------------------------------------------
00488651   1/1  ----------------------------------------------------------------------
00374371   1/1  ----------------------------------------------------------------------
00503641   1/1  ----------------------------------------------------------------------
00406191   1/1  ----------------------------------------------------------------------
00467611   1/1  ----------------------------------------------------------------------
00469731   1/1  ----------------------------------------------------------------------
00529641   1/1  ----------------------------------------------------------------------
00483641   1/1  ----------------------------------------------------------------------
00481081   1/1  ----------------------------------------------------------------------
00360161   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00382851   1/1  ----------------------------------------------------------------------
00419401   1/1  ----------------------------------------------------------------------