[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for elen0:ACV54398.1


[Show Plain Result]

## Summary of Sequence Search
   1::447
  18::441  1.8e-38 22.7% 0043886 00438861 1/1   l-CoA synthetase-like                   
  20::365  6.1e-34 24.6% 0042298 00422981 1/1   l-CoA synthetase-like                   
   7::365  1.4e-29 24.0% 0044590 00445901 1/1   l-CoA synthetase-like                   
  89::365  1.4e-28 25.0% 0040895 00408951 1/1   l-CoA synthetase-like                   
  93::410    7e-28 23.4% 0040451 00404511 1/1   l-CoA synthetase-like                   
  89::365  5.9e-21 23.5% 0043409 00434091 1/1   l-CoA synthetase-like                   
  89::365  8.7e-21 23.0% 0035109 00351091 1/1   l-CoA synthetase-like                   
   1::447


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAKDIPYDQKYYDPEIECMPRPELEALQLERLKDMVAYAYDNTVYYKRAFDEAGVKPGDIESLDDIAKFP
00438861   1/1  -----------------dltlldlleraaartpdrvaliflgegrrlTyaellervnrlaaaLlalgvkp
00422981   1/1  -------------------lladpdlllsdldllslaeyelllewnvtdpelfwdelaelldwlklldlv
00445901   1/1  ------pntelllpgpltl..hdlleraaartpdrvalvfedegelrrlTyaellervnrlaaaLlalgv
00408951   1/1  ----------------------------------------------------------------------
00404511   1/1  ----------------------------------------------------------------------
00434091   1/1  ----------------------------------------------------------------------
00351091   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           FCDKKTERETQHVGSFFGEMCSVPEEEVIFMATSSGSTGVPTVSPFTQEDFDLWQDTEARLFWQAGMRPN
00438861   1/1  gdrVaillpnspelvvallAvlkaGavyvplnpalpaerlayiledsgakllltddellelllelalpsl
00422981   1/1  lvldlllllpllrwflggrlntlhdllerqaartpdrpalifeddgdgelrtlTYaeldervnrlAaaLr
00445901   1/1  kpgdrValllpnspelvvallAvlkaGavyvplnpalpaerlayiledsgakllltdddllelllellae
00408951   1/1  ------------------plvpvdpddlayilyTSGTTGkPKgvvlthrnllanalalalal...gltpg
00404511   1/1  ----------------------vdpddlayilyTSGTTGkPKgvvlthrnllanalalaeallllgltpg
00434091   1/1  ------------------ppvpvdpddlayilyTSGTTGkPKgVvlthrnlllalalalalalg..ltpg
00351091   1/1  ------------------plvpvdpddlayilyTSGTTGlPKgvvlthrnllalalalalal...gltpg


                         +         -         -         -         -         *         -:210
query           DRYVHGLNFALYVGGPDVIGAQRLGALAIWVGAVPSDRLLFVLKQYQPTIIWTSPSYAWHLGEIAKEKGF
00438861   1/1  klvivldllslddllaag...saalpavpvdpddlayilyTSGTTGkPKgvvlthrnllanalalaral.
00422981   1/1  alGvkpgdrVaillpnspelvvallAvlkaGavyvplnptlpaerlayiledsgakllltddellellke
00445901   1/1  lpslklvivlddlallgllsledllaagp......plvpvdpddlayilyTSGTTGlPKgvvlthrnlla
00408951   1/1  drvlsflplfhvfglsvlellgallaGatlvllsgfdperllelieeykvtvlflvPtllrlllkapela
00404511   1/1  drvlsflplfhdagllellgallaGatlvllsgfdperllelieeykvtvlflvPtllrlllkapelagl
00434091   1/1  dvvlsflplfhdaglvlellgpllaGatlvllpglplrfdperlleliekyrvtvlflvPtllrlllkap
00351091   1/1  drvlsflplahdagllellaallaGatlvllsgpllfdperllelieeykvtvlflvPtllrlll.....


                         -         -         -         +         -         -         -:280
query           DPKEDFNIHTIIVAGEAGGSIKSTREAIENLWGAKVVDFYGLSDIYGACAAACEAHDGLHIVEDQILVET
00438861   1/1  llgltpgdrvlsflplfhdaglllellgalllGatlvllsgfdperllelieeykvtvlflvPtllrlll
00422981   1/1  ldlkelvdealelaelpslktvivlddlglladlallgvlslddllaagsaelpavpvdpddlayilyTS
00445901   1/1  nalalllalal...gltpgdvvlsflplfhdagllellgallaGatlvllsgrfdperlleliekykvtv
00408951   1/1  gldls...slrlllsgGeplp..pellerlrelfgvrllngYGlTEttvvvtlllpgldvkpgsiGrplp
00404511   1/1  dls...slrlllsgGeplpp..ellerlrelfpgvrllngYGlTEttvvvtllppg.dvkpgsigrplpg
00434091   1/1  ee.llakldlsslrlllsgGeplp..pellerfrelfglsgvrllngYGlTEttvvvtlnppglalpvkp
00351091   1/1  ....kadlsslrlllsgGeplp..pellerlre..gvrllngYGlTEttvvvtlllpgdllpvkpgsigr


                         -         *         -         -         -         -         +:350
query           VDPTTGEVLAPGETGELVYTTLCKKARPMIRFRTGDIGYVSTDTCECGRTLARIHVTGRKDEMFIVGAVN
00438861   1/1  kapeellaaldls...slrlllsgGeplp..pellerlrelfgvrllngYGlTEttgvvtlllpkpgsig
00422981   1/1  GTTGkPKgvvlthrnllanaaallalal...gltpgdrvlsflplahdaglllellgallaGatlvllsg
00445901   1/1  lflvPtllrlllkapelagldls...slrlllsgGeplp..pellerlre.lgvrllngYGlTEttvvvt
00408951   1/1  gvlevrivdpd.gepvppgevGelvirgpgvargYlndpeltaeafvedgwyrTGDlgrldedGy.....
00404511   1/1  vevrivdpedgepvppgevGelvvrgpgvargYlndpeltaeafvedgwyrTGDlgrldedGy.......
00434091   1/1  gsiGrplpgvevrivdedtgepvpplgevGeLvirgplpgvarGYlndpeltaeafvadpdgwyrTGDlg
00351091   1/1  plpgvevrivded.grpvppgevGellvrgpgvargYlndpeltaeafvedpfspgdgwyrTGDlgrlde


                         -         -         -         -         *         -         -:420
query           VFPSDIEYVVRGLDGLTGEYSIRVYEKNFTCKYEVSVERSLGSDEPYDEVASRTEAALKAHTGVRPAKVI
00438861   1/1  rplpgvevrivdpdeetgepvppgevGelvvrgppgvargYlndpeltaeafvdgwyrTGDlgrldedgy
00422981   1/1  apllfdperllelie-------------------------------------------------------
00445901   1/1  lllpglllllllldl-------------------------------------------------------
00408951   1/1  ...lyilGRlddqik-------------------------------------------------------
00404511   1/1  .lyilGRlddqikigGeriepgeiEavllshpavaeaaVvgvpdedggerlvafvvlkpg----------
00434091   1/1  rlded........Gy-------------------------------------------------------
00351091   1/1  dGy........lyil-------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           VYDAGKLGTSSEHKASRFIDERGCVTR-------------------------------------------
00438861   1/1  ........lyilGRlddqiki-------------------------------------------------
00422981   1/1  ----------------------------------------------------------------------
00445901   1/1  ----------------------------------------------------------------------
00408951   1/1  ----------------------------------------------------------------------
00404511   1/1  ----------------------------------------------------------------------
00434091   1/1  ----------------------------------------------------------------------
00351091   1/1  ----------------------------------------------------------------------