[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for elen0:ACV54491.1


[Show Plain Result]

## Summary of Sequence Search
   1::519
 443::512  2.5e-13 35.7% 0051317 00513171 1/1   minal effector domain of the bipartite  
 433::512  3.5e-13 33.8% 0048694 00486941 1/1   minal effector domain of the bipartite  
 451::512  1.1e-12 40.3% 0046851 00468511 1/1   minal effector domain of the bipartite  
 451::512  1.3e-12 41.9% 0047924 00479241 1/1   minal effector domain of the bipartite  
 449::512    6e-12 39.1% 0045681 00456811 1/1   minal effector domain of the bipartite  
 434::518  0.00014 22.0% 0049695 00496951 1/1   3 and sigma4 domains of RNA polymerase  
 410::512  0.00032 22.0% 0039239 00392391 1/1   3 and sigma4 domains of RNA polymerase  
   1::519


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTDERGSSPLALAIREVPGIAIASIGFGCALLAIEGDRLSTIRTVNISGDYHAVASLVSFLLLIMLALAY
00513171   1/1  ----------------------------------------------------------------------
00486941   1/1  ----------------------------------------------------------------------
00468511   1/1  ----------------------------------------------------------------------
00479241   1/1  ----------------------------------------------------------------------
00456811   1/1  ----------------------------------------------------------------------
00496951   1/1  ----------------------------------------------------------------------
00392391   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           RKLDAPTHVPAAIVIGAGALMSASMFVVLQQSVWEDNPIVSSIARIVFGLGEGVILFLWMKALFPYGARA
00513171   1/1  ----------------------------------------------------------------------
00486941   1/1  ----------------------------------------------------------------------
00468511   1/1  ----------------------------------------------------------------------
00479241   1/1  ----------------------------------------------------------------------
00456811   1/1  ----------------------------------------------------------------------
00496951   1/1  ----------------------------------------------------------------------
00392391   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           CAAVLGLGTIVVAAMNSLIAFLKVDAAYGTVSLLPIVSMVLLCYFREYARSRAPRADRDDIPSEDACASP
00513171   1/1  ----------------------------------------------------------------------
00486941   1/1  ----------------------------------------------------------------------
00468511   1/1  ----------------------------------------------------------------------
00479241   1/1  ----------------------------------------------------------------------
00456811   1/1  ----------------------------------------------------------------------
00496951   1/1  ----------------------------------------------------------------------
00392391   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           ERSMVAGIGCPDRSLIVPSDQAPRGRRVFVVTMMLSLACYAVVFGHIHYQWIPLQDGGTVSLIIQLGTAV
00513171   1/1  ----------------------------------------------------------------------
00486941   1/1  ----------------------------------------------------------------------
00468511   1/1  ----------------------------------------------------------------------
00479241   1/1  ----------------------------------------------------------------------
00456811   1/1  ----------------------------------------------------------------------
00496951   1/1  ----------------------------------------------------------------------
00392391   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           GTACGGAAILVLVQYFWNRRSLELYKVFLIPTVLLALWLSSFVNETWIFLYLVLLNITQKLVFLFIMLAP
00513171   1/1  ----------------------------------------------------------------------
00486941   1/1  ----------------------------------------------------------------------
00468511   1/1  ----------------------------------------------------------------------
00479241   1/1  ----------------------------------------------------------------------
00456811   1/1  ----------------------------------------------------------------------
00496951   1/1  ----------------------------------------------------------------------
00392391   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           FLIESKRPYLMPWCVAFLSFTAGKAASSLLLEHMSPDVFVSSSVIALVVLFACGAITSLSGSITDYHTPI
00513171   1/1  ----------------------------------------------------------------------
00486941   1/1  ----------------------------------------------------------------------
00468511   1/1  ----------------------------------------------------------------------
00479241   1/1  ----------------------------------------------------------------------
00456811   1/1  ----------------------------------------------------------------------
00496951   1/1  ----------------------------------------------------------------------
00392391   1/1  -----------------------------------------------------------lpvgddddlel


                         -         -         +         -         -         -         -:490
query           RGQWPGPDAPDVHDALPHANKLQNACHALTDQYQLTGREEEILVLLARGRTAQHIADTLVITQSTAKTHL
00513171   1/1  ----------------------lllldllallllLtprElevlrllaeglsnkeIAellgisekTVkthl
00486941   1/1  ------------lllelllllllllalllaalalLtprErevlrllaeGlsnkeIAerlgisekTVkthl
00468511   1/1  ------------------------------pllsLtprElevlrllaeglsnkeiAellgisekTVkthl
00479241   1/1  ------------------------------dllsLtprelevlrllaeGlsnkeiAellgisekTVkthl
00456811   1/1  ----------------------------ddllllLtprelevlrllaeglsnkeiAellgisekTVkthl
00496951   1/1  -------------elleeellrelleeal...etLsererevlrlryGlldlegltleeiAevlgvsrer
00392391   1/1  ldllpdddapspeelleaeelrellleaLek...LpererevlrlryGlldlegltleeiAeilgvsrer


                         *         -         -         -         -         +         -:560
query           RNIYAKMDVHNQQEILNLVEQTIDEQKKA-----------------------------------------
00513171   1/1  srilrKlgvrsraelvalalel------------------------------------------------
00486941   1/1  srilrKlgvrnraelvalalrl------------------------------------------------
00468511   1/1  snilrKlgvssraelvalalrl------------------------------------------------
00479241   1/1  snilrklgvrsraelvalalrl------------------------------------------------
00456811   1/1  snilrKlgvrsraelvalalel------------------------------------------------
00496951   1/1  VrqiekralkkLrkalraellrllllll------------------------------------------
00392391   1/1  VrqiesrAlkkLrkllrsqllk------------------------------------------------