[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for elen0:ACV54505.1


[Show Plain Result]

## Summary of Sequence Search
   1::520
 451::520  1.1e-12 40.0% 0051317 00513171 1/1   minal effector domain of the bipartite  
 441::520  7.5e-12 36.2% 0048694 00486941 1/1   minal effector domain of the bipartite  
 459::520  2.3e-11 41.9% 0046851 00468511 1/1   minal effector domain of the bipartite  
 459::520  7.2e-11 43.5% 0047924 00479241 1/1   minal effector domain of the bipartite  
 457::520  1.5e-10 40.6% 0045681 00456811 1/1   minal effector domain of the bipartite  
   1::520


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPALRRSIQSSARELARVIARDGAASFVLAVVGLACCFVFCSMGSSVETVAMRSSELFAPSGQADALPTF
00513171   1/1  ----------------------------------------------------------------------
00486941   1/1  ----------------------------------------------------------------------
00468511   1/1  ----------------------------------------------------------------------
00479241   1/1  ----------------------------------------------------------------------
00456811   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           AVTAGSLAAYALFGWAPLRAVDRVRGSMPVYAVCCVALAAVYAVTSLPVLSDASGARALLLVLRGFLGVT
00513171   1/1  ----------------------------------------------------------------------
00486941   1/1  ----------------------------------------------------------------------
00468511   1/1  ----------------------------------------------------------------------
00479241   1/1  ----------------------------------------------------------------------
00456811   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           TLVSWFALLGDRPRLFQVSAIAVAFAATALADLAFLALQAAVGFALLVALPLLSLGAYRVVARKRSGAGA
00513171   1/1  ----------------------------------------------------------------------
00486941   1/1  ----------------------------------------------------------------------
00468511   1/1  ----------------------------------------------------------------------
00479241   1/1  ----------------------------------------------------------------------
00456811   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           AAAAPAGAASAAAVGDAEPSRAASGGVARVLGSPILFCLLAGAVLGCIQGVGADLVLAHEQLAGGYVANN
00513171   1/1  ----------------------------------------------------------------------
00486941   1/1  ----------------------------------------------------------------------
00468511   1/1  ----------------------------------------------------------------------
00479241   1/1  ----------------------------------------------------------------------
00456811   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LLVAAALAIAAALVGGGAAFAHDGDDARLLAYARLTVIVALVLALCLANVLMMSGTFVSLTAAKLIGALL
00513171   1/1  ----------------------------------------------------------------------
00486941   1/1  ----------------------------------------------------------------------
00468511   1/1  ----------------------------------------------------------------------
00479241   1/1  ----------------------------------------------------------------------
00456811   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           LAYAWFAACARPGARAVRALTRMLVCWQVAAALLQAAVMAMAGEGPVQVVNVIVVILLGAVLVMQLFPLF
00513171   1/1  ----------------------------------------------------------------------
00486941   1/1  ----------------------------------------------------------------------
00468511   1/1  ----------------------------------------------------------------------
00479241   1/1  ----------------------------------------------------------------------
00456811   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           LSSRPATFPTGPSNGQTRSQALSISADEADLALVERFADEYGLTPRERELLGFFAQGYSVAYASEQLVLS
00513171   1/1  ------------------------------lllldllallllLtprElevlrllaeglsnkeIAellgis
00486941   1/1  --------------------lllelllllllllalllaalalLtprErevlrllaeGlsnkeIAerlgis
00468511   1/1  --------------------------------------pllsLtprElevlrllaeglsnkeiAellgis
00479241   1/1  --------------------------------------dllsLtprelevlrllaeGlsnkeiAellgis
00456811   1/1  ------------------------------------ddllllLtprelevlrllaeglsnkeiAellgis


                         *         -         -         -         -         +         -:560
query           PYTVRTHLRNIYVKTDTHSRDDLLALLKTY----------------------------------------
00513171   1/1  ekTVkthlsrilrKlgvrsraelvalalel----------------------------------------
00486941   1/1  ekTVkthlsrilrKlgvrnraelvalalrl----------------------------------------
00468511   1/1  ekTVkthlsnilrKlgvssraelvalalrl----------------------------------------
00479241   1/1  ekTVkthlsnilrklgvrsraelvalalrl----------------------------------------
00456811   1/1  ekTVkthlsnilrKlgvrsraelvalalel----------------------------------------