[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for elen0:ACV54563.1


[Show Plain Result]

## Summary of Sequence Search
   1::474
 392::470  1.3e-11 34.2% 0048694 00486941 1/1   minal effector domain of the bipartite  
 402::471  8.3e-11 40.0% 0051317 00513171 1/1   minal effector domain of the bipartite  
 410::470  5.9e-10 41.0% 0046851 00468511 1/1   minal effector domain of the bipartite  
 410::470  1.8e-09 41.0% 0047924 00479241 1/1   minal effector domain of the bipartite  
 408::470  5.4e-09 41.3% 0045681 00456811 1/1   minal effector domain of the bipartite  
   1::398  0.00075 20.4% 0042501 00425011 1/1   eneral substrate transporter            
   1::474


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQQATGGEKSRVVAKPARSDIQRGGIALDAFASALFWGYVAIMFGSSEIKIAESIGLAPENVALICGNVV
00486941   1/1  ----------------------------------------------------------------------
00513171   1/1  ----------------------------------------------------------------------
00468511   1/1  ----------------------------------------------------------------------
00479241   1/1  ----------------------------------------------------------------------
00456811   1/1  ----------------------------------------------------------------------
00425011   1/1  Msdsssseeddpelprpllrrrrwrillllflgyflagldrsiigpalpll.edlglsaaqaglllsaff


                         -         -         *         -         -         -         -:140
query           ALVAVGLLGPRAHGSHLFVLGLAGSGTACILQTVSLLSPEMVPVAWSRLFACGASAILVLAWCEHISSET
00486941   1/1  ----------------------------------------------------------------------
00513171   1/1  ----------------------------------------------------------------------
00468511   1/1  ----------------------------------------------------------------------
00479241   1/1  ----------------------------------------------------------------------
00456811   1/1  ----------------------------------------------------------------------
00425011   1/1  lgyalgallaGplaDrfGrrrvlllglllfalgslllalaallgpslalllllrflqGlgagglfpaala


                         +         -         -         -         -         *         -:210
query           SQERPLFLALCSLLTIVIVLVSIQLGARSAILFGGVLPVVSAALGAYRTRASARTAPSVTIQPPFPLYLI
00486941   1/1  ----------------------------------------------------------------------
00513171   1/1  ----------------------------------------------------------------------
00468511   1/1  ----------------------------------------------------------------------
00479241   1/1  ----------------------------------------------------------------------
00456811   1/1  ----------------------------------------------------------------------
00425011   1/1  llaewfppkergralglfgaggglGgalgpllggllleldlgWrwafliaailalllalllllllpespr


                         -         -         -         +         -         -         -:280
query           VILFVFGFMISFFSLLNRRTGTVENFMIPAGIDPFLAGWTVLVLVIAGCVWMLLPQRHASLVTTVLIPLA
00486941   1/1  ----------------------------------------------------------------------
00513171   1/1  ----------------------------------------------------------------------
00468511   1/1  ----------------------------------------------------------------------
00479241   1/1  ----------------------------------------------------------------------
00456811   1/1  ----------------------------------------------------------------------
00425011   1/1  flllkglseeerkvlerrlkadaeakaasplsllellrnprflllllayfllflgfyglltflplylqev


                         -         *         -         -         -         -         +:350
query           SLGLLLPPFLRYGLQETLPAVVAFIVICEAIICSVGPSNAKKYFHIGSFTFVFWTRSFGLIGMIVGYAAA
00486941   1/1  ----------------------------------------------------------------------
00513171   1/1  ----------------------------------------------------------------------
00468511   1/1  ----------------------------------------------------------------------
00479241   1/1  ----------------------------------------------------------------------
00456811   1/1  ----------------------------------------------------------------------
00425011   1/1  lglsasqaglllalfglggilgsllagrlsdrlpegrrrrllliglllaalgllllallpgtslalllll


                         -         -         -         -         *         -         -:420
query           ILLFDIMKIAIDFDILLIMFAAYAILCLTVAVMLGRIGLKAPAERERESTPAAAAHALAERYGLTAREAE
00486941   1/1  -----------------------------------------lllelllllllllalllaalalLtprEre
00513171   1/1  ---------------------------------------------------lllldllallllLtprEle
00468511   1/1  -----------------------------------------------------------pllsLtprEle
00479241   1/1  -----------------------------------------------------------dllsLtprele
00456811   1/1  ---------------------------------------------------------ddllllLtprele
00425011   1/1  lfllgfglggafpllfalvaelfppelrgtasgllnlagnlggallgp----------------------


                         -         -         +         -         -         -         -:490
query           VLELVAQGRNMTYVQKALCISPGTSSTHINHIHQKLDVHSREELIDLVQEELAR----------------
00486941   1/1  vlrllaeGlsnkeIAerlgisekTVkthlsrilrKlgvrnraelvalalr--------------------
00513171   1/1  vlrllaeglsnkeIAellgisekTVkthlsrilrKlgvrsraelvalalel-------------------
00468511   1/1  vlrllaeglsnkeiAellgisekTVkthlsnilrKlgvssraelvalalr--------------------
00479241   1/1  vlrllaeGlsnkeiAellgisekTVkthlsnilrklgvrsraelvalalr--------------------
00456811   1/1  vlrllaeglsnkeiAellgisekTVkthlsnilrKlgvrsraelvalale--------------------
00425011   1/1  ----------------------------------------------------------------------