[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for elen0:ACV54696.1


[Show Plain Result]

## Summary of Sequence Search
   1::163
  20::143  1.9e-12 40.0% 0051724 00517241 1/1   lpha NTP pyrophosphatases               
  19::139  1.2e-11 40.2% 0051439 00514391 1/1   lpha NTP pyrophosphatases               
  21::145  1.5e-11 39.6% 0051426 00514261 1/1   lpha NTP pyrophosphatases               
  18::141  4.4e-10 26.5% 0050254 00502541 1/1   lpha NTP pyrophosphatases               
  19::69    0.0002 43.1% 0051216 00512161 1/2   lpha NTP pyrophosphatases               
 107::138  0.00027 40.6% 0051216 00512162 2/2   lpha NTP pyrophosphatases               
   1::163


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSQKTYIPSGEMPPSSQIGATFEALAATIAARREAGEESYTYRLLTGSLDGVLKKVMEEAGETALAAKDV
00517241   1/1  -------------------dvldeLlalileralklpegsytvgllwkgldkilkkvgEEavEvveaakd
00514391   1/1  ------------------ldvlseLlellleralklpegsytvgllekgldkilkkvgEEavEvviaakd
00514261   1/1  --------------------vldeleklllaraaklpeksytvgllekgldkilkkvgEEavEvviaakd
00502541   1/1  -----------------vplslpellkiiqelaaevgfdw.......gpeslllklleEagElaeaiek.
00512161   1/2  ------------------ldvlseLeellleraaklpegsytaglleqgldkilkkvgEEavEvveaak-
00512162   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           ESWACSSLAASIAASGAVDETDELAVDLPPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNN
00517241   1/1  ..................................gdkeelaeElaDLlfhllvllrllgvdledvlrkli
00514391   1/1  ..................................gdkeelaeElaDLlfhllvllralgvdledvlreL-
00514261   1/1  ..................................gdkeelaeElaDllfhllvllrllgvdledvlekli
00502541   1/1  .................................edkeelaeElgDvlfylvvlarllgidledvlrelle
00512161   1/2  ----------------------------------------------------------------------
00512162   2/2  ------------------------------------eelaeElaDllfhllvllrllgvdledvlreL--


                         +         -         -         -         -         *         -:210
query           RMTDAERPEGGVRLHEDHVKRGK-----------------------------------------------
00517241   1/1  rRf-------------------------------------------------------------------
00514391   1/1  ----------------------------------------------------------------------
00514261   1/1  rRfgh-----------------------------------------------------------------
00502541   1/1  K---------------------------------------------------------------------
00512161   1/2  ----------------------------------------------------------------------
00512162   2/2  ----------------------------------------------------------------------