[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for elen0:ACV54955.1


[Show Plain Result]

## Summary of Sequence Search
   1::381
   1::377 1.2e-135 52.3% 0049115 00491151 1/1   guanine transglycosylase                
   2::376   1e-125 50.5% 0047415 00474151 1/1   guanine transglycosylase                
   1::381


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MALFDCELQATSGHARALSYETAHGSFQTPMFMPVGTSASVKGVTVGQLNDLNAQVVLANTYHLSLRPGA
00491151   1/1  lmamkFellktdgaaRlGrLttphgtietPafmpvgtrgtvkhltpdelkelgaqiiltntyhlllrpgl
00474151   1/1  -mtmkFeilkrdgaARlgvlttphgtvetPafmpvgtlg.vkaltpeelkelgaqiilvntyhlllrpgl


                         -         -         *         -         -         -         -:140
query           DVVAEAGGVHRFMNYDGPMLTDSGGFQVFSLADTLKLDDEGLTFRSIYDGTKVRWTPESNMEIQEQLGAD
00491151   1/1  evlaklggLhkflgwdgpiltdsggfqvfslsklrkiteegvtfssptdggrilltpeesieiqnalgpD
00474151   1/1  eliallgglhkflgwdgpiltDsGgfqvfsl...................gkilltpeesieiqralgsd


                         +         -         -         -         -         *         -:210
query           IAMQLDQCTPYPAEKAFVAKAVDLSANWARRCLAAHQRPDQTLFGIVQGGMELDLRLESIRRLREIEDES
00491151   1/1  iivaLdectplpasrkraeksverTlrwlercleahkkseklgldqalfgivqGglyldlrlesaeelae
00474151   1/1  iimaldectpppasreraeksverTlrwaercleah...nqalfgiiqgglyldlrersaeelael....


                         -         -         -         +         -         -         -:280
query           LARGGRRFGGFGIGGYSVGEDHEVMFETLGPVARACPEDRPRYLMGVGNPTTLVRAVREGVDMFDCVLPT
00491151   1/1  lg..........fdgyaigglsvgeekeemlelveavlpllpedkprylmgvgtPedillavalGvDlfd
00474151   1/1  ......gfdgyaigglvvgeekeeyallleileallellppdkprylmGvgtPedilllvalGvDlfDsv


                         -         *         -         -         -         -         +:350
query           RTARMGTAFSSTGRMNMRNAKFTRDFGPLDPACTCPTCRNHSRAYIRHLVKQNEMLGGILLSVHNLHYLI
00491151   1/1  cvlptrlArngraltfdgtlnLknakyaldfsPldegCdCytCrnysraYlhhLlkakEllglrlltiHN
00474151   1/1  sptryArngraltpdgtlr........dfepldepcdcytcknysraylhhllkaeell...lltiHNly


                         -         -         -         -         *         -         -:420
query           DLMRRAREAVLAGAYEEFYEAWMASPAAKDY---------------------------------------
00491151   1/1  lhfylrlmreiReailegtllefveef-------------------------------------------
00474151   1/1  fllelmeeiReaIkegtlrefveefl--------------------------------------------