[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for elen0:ACV54981.1


[Show Plain Result]

## Summary of Sequence Search
   1::235
   1::194  8.8e-37 29.9% 0043525 00435251 1/1   like                                    
   1::137  2.4e-36 36.5% 0050341 00503411 1/1   like                                    
   1::121    5e-36 40.8% 0051573 00515731 1/1   like                                    
   1::139  8.2e-36 38.0% 0050342 00503421 1/1   like                                    
   1::130  1.4e-35 36.9% 0039925 00399251 1/1   like                                    
   1::122  3.7e-34 41.0% 0047799 00477991 1/1   like                                    
   1::128  5.7e-34 39.8% 0047753 00477531 1/1   like                                    
   1::122  1.4e-33 40.2% 0047555 00475551 1/1   like                                    
   2::121  2.7e-33 41.2% 0051574 00515741 1/1   like                                    
   1::121  3.8e-33 41.3% 0051386 00513861 1/1   like                                    
   2::133  4.6e-33 38.6% 0048975 00489751 1/1   like                                    
   2::138  4.9e-33 38.7% 0048465 00484651 1/1   like                                    
   1::120  7.1e-33 41.7% 0048231 00482311 1/1   like                                    
   1::127  9.3e-33 39.4% 0051318 00513181 1/1   like                                    
   1::117  9.7e-33 39.3% 0048656 00486561 1/1   like                                    
   1::120  1.1e-32 41.7% 0045852 00458521 1/1   like                                    
   1::131  1.5e-32 40.5% 0047296 00472961 1/1   like                                    
   1::121  1.7e-32 41.3% 0048705 00487051 1/1   like                                    
   1::121  1.8e-32 40.5% 0046294 00462941 1/1   like                                    
   1::121  2.4e-32 40.5% 0047867 00478671 1/1   like                                    
   1::119  4.4e-32 40.3% 0049456 00494561 1/1   like                                    
   1::117  4.9e-32 39.3% 0049761 00497611 1/1   like                                    
   1::120  8.5e-32 41.7% 0046428 00464281 1/1   like                                    
   1::122  8.5e-32 42.0% 0048685 00486851 1/1   like                                    
   1::121  9.3e-32 41.7% 0050964 00509641 1/1   like                                    
   1::135  9.8e-32 38.8% 0045700 00457001 1/1   like                                    
   1::121  1.2e-31 40.5% 0048129 00481291 1/1   like                                    
   1::129  1.3e-31 40.3% 0045682 00456821 1/1   like                                    
   2::124  1.4e-31 34.4% 0046299 00462991 1/1   like                                    
   2::126  2.5e-31 38.4% 0051860 00518601 1/1   like                                    
   2::121  4.8e-31 41.2% 0048463 00484631 1/1   like                                    
   1::119  6.2e-31 42.2% 0048066 00480661 1/1   like                                    
   1::122  3.1e-28 39.1% 0051898 00518981 1/1   like                                    
 125::231  3.7e-28 43.4% 0051385 00513851 1/1   minal effector domain of the bipartite  
 133::231  4.1e-28 45.5% 0048619 00486191 1/1   minal effector domain of the bipartite  
 129::231  5.3e-28 45.1% 0047798 00477981 1/1   minal effector domain of the bipartite  
 128::231  2.8e-27 45.6% 0049014 00490141 1/1   minal effector domain of the bipartite  
 132::230  5.8e-27 42.3% 0048684 00486841 1/1   minal effector domain of the bipartite  
 130::229  6.1e-23 44.7% 0052669 00526691 1/1   minal effector domain of the bipartite  
   1::119  9.8e-23 40.4% 0048997 00489971 1/1   like                                    
  14::139  4.5e-15 23.8% 0035625 00356251 1/1   amin (vitamin B12)-binding domain       
   1::235


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKILLIDDENSIARLVGSMAGDAGYAFAYAEDGAEGLVVAEREAPDLVIMDVMMPRMDGFTTCRLMRER
00435251   1/1  msglrvLvVDDdplirellrrlLerlgyevvgtaadgeeAlelleelppdlvllDirmPgmdGlellrrl
00503411   1/1  glriLvVdDdpllrellrllLeklgyevltaadgeealellrelrpdlvllDimmPgmdGlellrrlrel
00515731   1/1  glriliVdDdpllrellallLeklgyvvltaadgeealellrelrpdlvllDimmPgmdGlellrrlre.
00503421   1/1  llllllsllllsglriLvVdDdplirellarlLeklgyev..aadgeealellrelppdlvllDlmmPgm
00399251   1/1  plslsglrvLvVdDdplirellrrlLeklgylevvltaadgeealellrelgalaglelglrpdlvllDi
00477991   1/1  glrilvvdDdpllrellallLeklgyvvltaadgeealellrelppdlvllDimmPgmdGlellrrlrel
00477531   1/1  kglriLiVdDdplirellrrlLeklgllyvvltaadgeealellrellalgslerpdlvllDlnmPgmdG
00475551   1/1  llsglriLvVdDdpllrellrllLeklgyevvleaadgeealellrelrpdlvllDlmmPgmdGlellrr
00515741   1/1  -lriLvvdDdpllrellrllLeslgyvvleaadgeealellrelrpdlvllDlmmPgmdGlellrrlre.
00513861   1/1  glrilvvdDdpllrellallLeslgyvvltaadgeealellrelrpdlvllDlmmPgmdGlellrrlrel
00489751   1/1  -lriliVdDdplirellrllLerlgyevltaadgeealellrelrpdlvllDirmPgmdGlellrrlrel
00484651   1/1  -lriLiVdDdplirellrllLeklgyevltaadgeealelleelrpdlvllDlmmPgmdGlellrrlrel
00482311   1/1  sglrilvvdDdpllrellallLeklgyvvltaadgeealellrelrpdlvllDimmPgmdGlellrrlre
00513181   1/1  sglrilvVdDdplirellrllLeslgyevltaadgeealellrelrpdlvllDirmPgmdGlellrrlre
00486561   1/1  glrilvvdDdpllrellkllLeklgyevvlvaadgeealellrellesglrpdlvllDilmPgmdGlell
00458521   1/1  glriLvVdDdpllrellallLeslgyvvltaadgeealellrelrpdlvllDlmmPgmdGlellrrlrel
00472961   1/1  lsglriLiVdDdplirellrrlLeklgllyevleaadgeealellrellelgdllrpdlvllDlnmPgmd
00487051   1/1  llllsglriLvVdDdplirellallLeslgyevvltaadgeealellrelppdlvllDlmmPgmdGlell
00462941   1/1  lsklriliVdDdplvrellallLeslgyvvltaadgeealellrelrpdlvllDlrmPgmdGlellrrlr
00478671   1/1  lsglrilvvdDdpllrellallLeslgyvvltaadgeealellrelrpdlvllDlrmPgmdGlellrrlr
00494561   1/1  klrilivdDdpllrellallLeslgyvvltaadgeealellrelrpdlvllDllmPgmdGlellrrlrel
00497611   1/1  glrilivdDdpllrellallLeklgyevvgeaadgeealellrelrpdlvllDllmPgmdGlellrrlre
00464281   1/1  klrilivdDdpllrellrllLeslgllyvvltaadgeealelleelrpdlvllDimmPgmdGlellrrlr
00486851   1/1  sglrilivdDdpllrellallLeslgyvvltaadgeealelle...pdlvllDilmPgmdGlellrrlre
00509641   1/1  sglrilvVdDdpllrellrllLeslgyevltaadgeealelleelrpdlvllDimmPgmdGlellrrlre
00457001   1/1  lsklriliVdDdplirellrrlLeslgdlyvvltaadgeealellrelrpdlvllDlmmPgmdGlellrr
00481291   1/1  glriLvvdDdpllrellallLeklgyvvltaadgeealellrelrpdlvllDimmPgmdGlellrrlrel
00456821   1/1  kklriliVdDdplirellrrlLeslgdlyvvleaadgeealellrelrpdlvllDlmmPgmdGlellrrl
00462991   1/1  -lllelsglrvLvVdDnplnrellkalLeklgyevltasngeealell.elppdlvllDiqmPgmdGlel
00518601   1/1  -ealsslsglrilvVdDdplvrellrrlLerlgyevvtaadgeealellrelppdlvllDlrmpgmdGle
00484631   1/1  -lrilivdDdpllrellallLeklgyvvltaadgeealellrelrpdlvllDimmPgmdGlellrrlre.
00480661   1/1  lrsklrilivdddpalrellrrlLeaegyqvlvaesgeealelleehrpdlvlldlmlPgmdglellrqL
00518981   1/1  sglrilvvdDdpllrellallLeslgyevvtaadgeealellrelerpdllvllD.llPgmdGlellrrl
00513851   1/1  ----------------------------------------------------------------------
00486191   1/1  ----------------------------------------------------------------------
00477981   1/1  ----------------------------------------------------------------------
00490141   1/1  ----------------------------------------------------------------------
00486841   1/1  ----------------------------------------------------------------------
00526691   1/1  ----------------------------------------------------------------------
00489971   1/1  ltllllknlrglrilvvdddplvrellrrlLerlgyevvaaadgeeale....lrpdlvlldlrmpdmdg
00356251   1/1  -------------knlvaliLedaGfeVidlGvdvpveeiveaakeedadviglsslltphldglkevle


                         -         -         *         -         -         -         -:140
query           GITCPVIFLSAKGDIVDKGVGFQAGGDDYMVKPFDPRELLMHIEAHLRRASMAAAPVAPRGDILHAGRFV
00435251   1/1  re.lpdipvillTayadeedavraleaGaddyltKPfdleeLlaalrralerrrllre......lrllle
00503411   1/1  pllpdipvillTalddeedavraleagaddyltKPfdleeLlarirallrrlrllsellllleelel---
00515731   1/1  lpdipvillTaladeedavraleagaddyllKPfdleeLlaalrallrrlr-------------------
00503421   1/1  dGlellrrlrelpalpdipvillTalddeedrvraleaGaddyltKPfdpeeLlarirallrrrrllre-
00399251   1/1  nmPgmdGlellrrlralpllpdipvivlTaladeedrvraleaGaddyllKPfdleeLla----------
00477991   1/1  gpdipvillTaladeedavraleagaddyllKPfdleeLlaalrallrrlrl------------------
00477531   1/1  lellrrlrelpllpdipvivlTalddeedavraleagaddyllKPfdleeLlaairal------------
00475551   1/1  lrelpllpdipvillTaladeedavraleagaddyllKPfdleeLlaalral------------------
00515741   1/1  lpdipvivlTalddeedavraleagaddyllKPfdleeLlaalrallrrlr-------------------
00513861   1/1  gpdipvivlTaladeedavraleagaddyllKPfdleeLlaalrallrrlr-------------------
00489751   1/1  gpdlpvillTayddeedavraleagaddyllKPfdleeLlaairallrrlrllrellllllll-------
00484651   1/1  gpdipvillTayadeedavealeagaddyllKPfdleeLlaairallrrlrllrelllllellelllg--
00482311   1/1  lgpdipvillTalddeedavraleagaddyllKPfdleeLlaalrallrr--------------------
00513181   1/1  llpdipvillTayddeedavraleagaddyllKPfdleeLlaairallrrlrllsen-------------
00486561   1/1  rrlrelllpdipvillTaladeedavraleagaddyllKPfdleeLl-----------------------
00458521   1/1  lllpdipvillTaladeedavraleagaddyllKPfdleeLlaairallr--------------------
00472961   1/1  GlellrrlrelpalpdipvivlTalddeedavraleagaddyltKPfdleeLlaairallr---------
00487051   1/1  rrlrelpllpdipvillTaladeedavraleagaddyllKPfdleeLlaal-------------------
00462941   1/1  ellpdipvillTayddeedavealeagaddyllKPfdleeLlaairallrr-------------------
00478671   1/1  ellpdlpvillTaladeedavraleagaddyllKPfdleeLlaairallrr-------------------
00494561   1/1  lpdipvillTayadledavraleagaddyllKPfdleeLlaalrallrr---------------------
00497611   1/1  llpdlpvivlTaladeedavealeagaddyllKPfdleeLlaalral-----------------------
00464281   1/1  elplpdipvivlTaladeedavraleagaddyllKPfdleeLlaalrall--------------------
00486851   1/1  llpdipvillTalddeedavealeagaddyllKPfdleeLlaairallrrlr------------------
00509641   1/1  .lpdipvillTaladeedavraleagaddyllKPfdleeLlaalrallrrr-------------------
00457001   1/1  lre.lpdipvivlTalddelledavraleagaddyllKPfdleeLlaairallrrlrllsellal-----
00481291   1/1  palpdipvillTaladeedavraleagaddyllKPfdleeLlaalrallrr-------------------
00456821   1/1  rellpdipvivlTayddeedavraleagaddyllKpfdleeLlaairallrrlrllsel-----------
00462991   1/1  lrrirelellpllpdipiialtayadeedreraleagaddyltKPvsleeLlaa----------------
00518601   1/1  llrrlrellpdipvillTayadeedavraleagaddyllKPfdleeLlaalrallr--------------
00484631   1/1  lpdipvillTalddeedavraleagaddyllKPfdleeLlaalrallrrlr-------------------
00480661   1/1  reeglllPvilltard...drvaaldagaddyltkPfllpvdqleeLla---------------------
00518981   1/1  rellpdlpvillTaldde..avraleag.ddyllKPfdleeLlaalr...rr------------------
00513851   1/1  ------------------------------------------------------rsaglesevllfgdlv
00486191   1/1  --------------------------------------------------------------vlrfgdlv
00477981   1/1  ----------------------------------------------------------eesdvlllgdlv
00490141   1/1  ---------------------------------------------------------llesdvllfgdlv
00486841   1/1  -------------------------------------------------------------evlrlgdlv
00526691   1/1  -----------------------------------------------------------llevlllgdlt
00489971   1/1  lellallre.lpdlpvivltayedpelleaaleagaldylvkPldpeeL---------------------
00356251   1/1  eLreagldipvlvGGalvsrdfaalkilglelgadayftdafsavelaarllsllrrsdlleelllele-


                         +         -         -         -         -         *         -:210
query           LDRGQFRVTKDGERLSLTPKEFKIFFALASSPGLVLSKEQLVEAAWGKEFVGETSSITVFIKKLREKVED
00435251   1/1  llelllelrlllldallllliglslallellallrklilgesgtgkelvaralh----------------
00503411   1/1  ----------------------------------------------------------------------
00515731   1/1  ----------------------------------------------------------------------
00503421   1/1  ----------------------------------------------------------------------
00399251   1/1  ----------------------------------------------------------------------
00477991   1/1  ----------------------------------------------------------------------
00477531   1/1  ----------------------------------------------------------------------
00475551   1/1  ----------------------------------------------------------------------
00515741   1/1  ----------------------------------------------------------------------
00513861   1/1  ----------------------------------------------------------------------
00489751   1/1  ----------------------------------------------------------------------
00484651   1/1  ----------------------------------------------------------------------
00482311   1/1  ----------------------------------------------------------------------
00513181   1/1  ----------------------------------------------------------------------
00486561   1/1  ----------------------------------------------------------------------
00458521   1/1  ----------------------------------------------------------------------
00472961   1/1  ----------------------------------------------------------------------
00487051   1/1  ----------------------------------------------------------------------
00462941   1/1  ----------------------------------------------------------------------
00478671   1/1  ----------------------------------------------------------------------
00494561   1/1  ----------------------------------------------------------------------
00497611   1/1  ----------------------------------------------------------------------
00464281   1/1  ----------------------------------------------------------------------
00486851   1/1  ----------------------------------------------------------------------
00509641   1/1  ----------------------------------------------------------------------
00457001   1/1  ----------------------------------------------------------------------
00481291   1/1  ----------------------------------------------------------------------
00456821   1/1  ----------------------------------------------------------------------
00462991   1/1  ----------------------------------------------------------------------
00518601   1/1  ----------------------------------------------------------------------
00484631   1/1  ----------------------------------------------------------------------
00480661   1/1  ----------------------------------------------------------------------
00518981   1/1  ----------------------------------------------------------------------
00513851   1/1  ldlasrevtldgeeieLtpkefdlLllLlrnpgrvlsreqLleavwgldllvddrtldvhisrLRkkle.
00486191   1/1  ldlasrevlldgelveLtpkefdlLllLlenpgrvlsreqLleavwgldllvddrtldvhisrLRkkled
00477981   1/1  ldlasrevtldgeeieLtpkefelLllLlrnpgrvlsreeLleavwgldllvddntldvhisrLRkkle.
00490141   1/1  ldlasrevtldgeeieLtpkefelLllLlrnpgrvlsreqLleavwgldllvddrtldvhisrLRkkle.
00486841   1/1  ldlasrevlldgeeieLtpkefelLllLlenpgrvvsreeLleavwgld..vddntldvhisrLRkkled
00526691   1/1  ldld......dgevvlltpkefalLalLllnpgrvvsreeLleavwgddlpavadntldvhisrLRkkLg
00489971   1/1  ----------------------------------------------------------------------
00356251   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           DPSDPRVIQTVWGIGYRFEPEGREG---------------------------------------------
00435251   1/1  ----------------------------------------------------------------------
00503411   1/1  ----------------------------------------------------------------------
00515731   1/1  ----------------------------------------------------------------------
00503421   1/1  ----------------------------------------------------------------------
00399251   1/1  ----------------------------------------------------------------------
00477991   1/1  ----------------------------------------------------------------------
00477531   1/1  ----------------------------------------------------------------------
00475551   1/1  ----------------------------------------------------------------------
00515741   1/1  ----------------------------------------------------------------------
00513861   1/1  ----------------------------------------------------------------------
00489751   1/1  ----------------------------------------------------------------------
00484651   1/1  ----------------------------------------------------------------------
00482311   1/1  ----------------------------------------------------------------------
00513181   1/1  ----------------------------------------------------------------------
00486561   1/1  ----------------------------------------------------------------------
00458521   1/1  ----------------------------------------------------------------------
00472961   1/1  ----------------------------------------------------------------------
00487051   1/1  ----------------------------------------------------------------------
00462941   1/1  ----------------------------------------------------------------------
00478671   1/1  ----------------------------------------------------------------------
00494561   1/1  ----------------------------------------------------------------------
00497611   1/1  ----------------------------------------------------------------------
00464281   1/1  ----------------------------------------------------------------------
00486851   1/1  ----------------------------------------------------------------------
00509641   1/1  ----------------------------------------------------------------------
00457001   1/1  ----------------------------------------------------------------------
00481291   1/1  ----------------------------------------------------------------------
00456821   1/1  ----------------------------------------------------------------------
00462991   1/1  ----------------------------------------------------------------------
00518601   1/1  ----------------------------------------------------------------------
00484631   1/1  ----------------------------------------------------------------------
00480661   1/1  ----------------------------------------------------------------------
00518981   1/1  ----------------------------------------------------------------------
00513851   1/1  dpgepllikTvrgvGYrlvae-------------------------------------------------
00486191   1/1  dglnpllikTvrgvGYrlvae-------------------------------------------------
00477981   1/1  dpgepllikTvrgvGYrlvae-------------------------------------------------
00490141   1/1  dpgapllikTvrgvGYrlvae-------------------------------------------------
00486841   1/1  lglnplliktvrgvGYrlve--------------------------------------------------
00526691   1/1  ddgldprliltvrgvGYrl---------------------------------------------------
00489971   1/1  ----------------------------------------------------------------------
00356251   1/1  ----------------------------------------------------------------------