[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for elen0:ACV55062.1


[Show Plain Result]

## Summary of Sequence Search
   1::359
 112::257  4.3e-17 28.3% 0050934 00509341 1/1   reductase molybdopterin-binding domain  
  52::263  8.9e-17 21.3% 0041847 00418471 1/1   reductase molybdopterin-binding domain  
  76::263  1.2e-16 24.5% 0043687 00436871 1/1   reductase molybdopterin-binding domain  
 258::350  2.1e-09 28.3% 0049432 00494321 1/1    domains                                
 258::350  4.1e-09 28.9% 0048564 00485641 1/1    domains                                
   1::359


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAYNPKKIAGGVAGGALLMFGAVGGIGATAGLPQTADADPIATTHAVGDNVVTAQWFNEDDVSYVSVANA
00509341   1/1  ----------------------------------------------------------------------
00418471   1/1  ---------------------------------------------------vdygdlstllalverlpll
00436871   1/1  ----------------------------------------------------------------------
00494321   1/1  ----------------------------------------------------------------------
00485641   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           QGAFTFNQEGVTPNDELFNVFGTALTSMCSKPATELVDVEGGVANFYVNVGGNIKKNFTIDVRDLAEDAN
00509341   1/1  -----------------------------------------ldprlvlllllhppnnleplpllllygni
00418471   1/1  vltlllplnalpplqlltegfitpnnlfyvrnhggvppa.idpddwrLevdGlvekpltltlddLlalpl
00436871   1/1  -----vtpdsvllrrsrlllllgalplnaepplqlllegfitPndlffvrnhggvpgidpedwrLevdGl
00494321   1/1  ----------------------------------------------------------------------
00485641   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           QETMMACSCATGSPFGQAAVMGVPLSAVVEMADLEDGVNTITAYGADGFGQPLPLRYALEKNALLAYQVN
00509341   1/1  tpfglffvrnhgpvpeldpddwrLevdGlvekpltlslddLlklfpleeriyrlrCvgnw.sgvapWtGv
00418471   1/1  veriatlvCvgnwskvinlvkkvkglqwgagavstalWtGvpLrdlLelagvkpklgskklgakyVlfeg
00436871   1/1  vekpltltlddLlallplveriarlrCvgnwsavlnlvkkvkglqwglgavstalWtGvpLrdlLelagv
00494321   1/1  ----------------------------------------------------------------------
00485641   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GQELEAATGSSLQLWMPETVARYFTRDIVNIELTQEDAEPDVQQVDPCYRNKINIMNYSDDCVFKAGDEI
00509341   1/1  pLrdlLelagpksgakyvlfegldgpellpgqrsllllglldwpyte-----------------------
00418471   1/1  addllegpglgYttslpldealdpgrdvlLAyemnGepLppehGyPlRlvvPg-----------------
00436871   1/1  kpgdlgakyvlfegaddlllglgyttslpldealdpnrdvlLAygmnGepLpp-----------------
00494321   1/1  -----------------------------------------------elnvnsvitsPadgevlp.ggtv
00485641   1/1  -----------------------------------------------elnvnsvitspadgevlp.ggtv


                         -         *         -         -         -         -         +:350
query           TFEGVADDLGSPIAAIEFSFDNGRTWTSCDTDGATADKWVNWQFTTSFEEKGDYRMTVRAKTADGMVSPL
00509341   1/1  ----------------------------------------------------------------------
00418471   1/1  ----------------------------------------------------------------------
00436871   1/1  ----------------------------------------------------------------------
00494321   1/1  tvrGyAwsgggrgierVevslDgGktWllAeldgpllpygllwawrlWsldldldlagalellvRAtDes
00485641   1/1  tvrGyAwsggGrgierVevslDgGktWllAeldgplgplrldllsggllwawrlWsldldld..galell


                         -         -         -         -         *         -         -:420
query           AATLLFEVA-------------------------------------------------------------
00509341   1/1  ----------------------------------------------------------------------
00418471   1/1  ----------------------------------------------------------------------
00436871   1/1  ----------------------------------------------------------------------
00494321   1/1  ----------------------------------------------------------------------
00485641   1/1  ----------------------------------------------------------------------