[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for elen0:ACV55075.1


[Show Plain Result]

## Summary of Sequence Search
   1::286
 146::286  6.5e-38 42.6% 0043988 00439882 2/2   ation factor Ts (EF-Ts), dimerisation d 
 149::286  1.7e-37 49.6% 0046542 00465422 2/2   ation factor Ts (EF-Ts), dimerisation d 
 137::287  3.8e-23 45.0% 0050904 00509042 2/2   ation factor Ts (EF-Ts), dimerisation d 
 176::286  1.6e-19 45.6% 0050903 00509032 2/2   ation factor Ts (EF-Ts), dimerisation d 
  56::148    1e-18 40.0% 0046544 00465441 1/2   ation factor Ts (EF-Ts), dimerisation d 
  54::150  3.1e-18 37.9% 0050903 00509031 1/2   ation factor Ts (EF-Ts), dimerisation d 
   2::55   3.3e-17 63.0% 0046543 00465431 1/1   ike                                     
   4::55   3.8e-17 61.5% 0035061 00350611 1/1   ike                                     
   4::54   5.3e-17 60.8% 0052216 00522161 1/1   ike                                     
   2::57   1.6e-16 60.7% 0050902 00509021 1/1   ike                                     
  57::144  1.2e-12 35.2% 0043988 00439881 1/2   ation factor Ts (EF-Ts), dimerisation d 
 149::284  9.5e-11 42.5% 0046544 00465442 2/2   ation factor Ts (EF-Ts), dimerisation d 
  48::134  7.8e-09 36.1% 0050904 00509041 1/2   ation factor Ts (EF-Ts), dimerisation d 
   8::41   5.1e-05 41.2% 0050610 00506101 1/1   ike                                     
  60::107      6.6 28.9% 0046542 00465421 1/2   ation factor Ts (EF-Ts), dimerisation d 
   1::286


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAAVTASMVKELREMTGAGMMECKKALVEADGNIDQAVDVLRTRGLAAVAKKAGRATNEGTVMAIVSDDA
00439882   2/2  ----------------------------------------------------------------------
00465422   2/2  ----------------------------------------------------------------------
00509042   2/2  ----------------------------------------------------------------------
00509032   2/2  ----------------------------------------------------------------------
00465441   1/2  -------------------------------------------------------vaaeGlvavyvh..g
00509031   1/2  -----------------------------------------------------grvaaeGlvavlv..dg
00465431   1/1  -leisaelvkeLrertgagmmeckkALeeangdlekAielLrekglakaakkagr---------------
00350611   1/1  ---isaelvkeLRektgaglmdckkaLeeangdlekaiellrekGlakaakkagr---------------
00522161   1/1  ---isaelvkeLrertgaglmdckkALeeangdlekAielLrekglakaakkag----------------
00509021   1/1  -leisaelvkeLrertgagmmdckkALeeangDlekAielLrekglakaakkagrlt-------------
00439881   1/2  --------------------------------------------------------aaeGlvavlisldg
00465442   2/2  ----------------------------------------------------------------------
00509041   1/2  -----------------------------------------------llrkkalrvaaeglvasyvhglg
00506101   1/1  -------kvkqlmemtgfseeevvaALrecnnDverAvnlL-----------------------------
00465421   1/2  -----------------------------------------------------------gvvgsYiH.gg


                         -         -         *         -         -         -         -:140
query           TSGAVVELNCETDFVGMNDKFKAYAEKIAQAALASKPADLEALKAADAAGETVEAVVTDAIHTLGENIQL
00439882   2/2  ----------------------------------------------------------------------
00465422   2/2  ----------------------------------------------------------------------
00509042   2/2  ------------------------------------------------------------------llrk
00509032   2/2  ----------------------------------------------------------------------
00465441   1/2  kigvlvelnsetdfvakneeflelakdvamhvaaakplv......vkddgktveellkeliakigenikl
00509031   1/2  klavlvelnceTDfvArnekFlelvkdvAmhvaalnplllkivegrlkkflkevvLleqafvkddsltve
00465431   1/1  ----------------------------------------------------------------------
00350611   1/1  ----------------------------------------------------------------------
00522161   1/1  ----------------------------------------------------------------------
00509021   1/1  ----------------------------------------------------------------------
00439881   1/2  klavlvelnceTDfvAkneeFlelakdlAmhiaalnPlylsledvpaellekereilleqallegkPeei
00465442   2/2  ----------------------------------------------------------------------
00509041   1/2  kigvlvelnsetdfv....kfeelakdvAmhvaamnPlylsvegrlnkflkevaLleqpfvldp------
00506101   1/1  ----------------------------------------------------------------------
00465421   1/2  kigvlvelegelee.........lakdlAmhiaalnP---------------------------------


                         +         -         -         -         -         *         -:210
query           ARFAVVEGGAVSSYIHGGGKIGVLVQFDVEGIDPASDGFKQFGRDVAMQVAAAAPVAATRESVDPAIVEH
00439882   2/2  -----aaeGlvavlisldgklavlvelnceTDfvAkneeFlelakdlAmhiaalnPlylsledvpaelle
00465422   2/2  --------gvvgsYiH.ggkigvlvelege........leelakdlAmhiaalnPlylsledvpaevvek
00509042   2/2  kalrvaaeglvasyvhglgkigvlvelnsetdfv...kfeelakdvAmhvaamnPlyls...........
00509032   2/2  -----------------------------------nekFlelvkdvAmhvaalnplll............
00465441   1/2  rrfvrlel--------------------------------------------------------------
00509031   1/2  ellkelikkl------------------------------------------------------------
00465431   1/1  ----------------------------------------------------------------------
00350611   1/1  ----------------------------------------------------------------------
00522161   1/1  ----------------------------------------------------------------------
00509021   1/1  ----------------------------------------------------------------------
00439881   1/2  leki------------------------------------------------------------------
00465442   2/2  --------Glvavyvh..gkigvlvelnsetdfvakneeflelakdvamhvaaakplv............
00509041   1/2  ----------------------------------------------------------------------
00506101   1/1  ----------------------------------------------------------------------
00465421   1/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           EKAIYMAQAAESGKPEAIQEKMATGRLEKFFKESTLTEQPFVKNPDQSVSEYAAEVAKNLGGEIKIVDFK
00439882   2/2  kereilleqallegkPeeilekiveGrlekflkevvLleqpfvkddkltveellkellkklgenikvvdf
00465422   2/2  ereilleqaklegkPeeilekiveGrlkkflkevvLleQpfvkddsltvgellk......genikvvrfv
00509042   2/2  ......................vegrlnkflkevaLleqpfvldpsktVgellk......gagakvvdfv
00509032   2/2  ....................kivegrlkkflkevvLleqafvkddsltveellkelikklgenvkvvrfv
00465441   1/2  ----------------------------------------------------------------------
00509031   1/2  ----------------------------------------------------------------------
00465431   1/1  ----------------------------------------------------------------------
00350611   1/1  ----------------------------------------------------------------------
00522161   1/1  ----------------------------------------------------------------------
00509021   1/1  ----------------------------------------------------------------------
00439881   1/2  ----------------------------------------------------------------------
00465442   2/2  ..........................................vkddgktveellkeliakigeniklrrf
00509041   1/2  ----------------------------------------------------------------------
00506101   1/1  ----------------------------------------------------------------------
00465421   1/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           RFVLGE----------------------------------------------------------------
00439882   2/2  vrfevG----------------------------------------------------------------
00465422   2/2  rfevGe----------------------------------------------------------------
00509042   2/2  rfevGeG---------------------------------------------------------------
00509032   2/2  rfevGe----------------------------------------------------------------
00465441   1/2  ----------------------------------------------------------------------
00509031   1/2  ----------------------------------------------------------------------
00465431   1/1  ----------------------------------------------------------------------
00350611   1/1  ----------------------------------------------------------------------
00522161   1/1  ----------------------------------------------------------------------
00509021   1/1  ----------------------------------------------------------------------
00439881   1/2  ----------------------------------------------------------------------
00465442   2/2  vrle------------------------------------------------------------------
00509041   1/2  ----------------------------------------------------------------------
00506101   1/1  ----------------------------------------------------------------------
00465421   1/2  ----------------------------------------------------------------------