[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for elen0:ACV55195.1


[Show Plain Result]

## Summary of Sequence Search
   1::461
  28::433   2e-104 34.9% 0042904 00429041 1/1   ophan synthase beta subunit-like PLP-de 
  37::434  5.8e-73 30.7% 0050098 00500981 1/1   ophan synthase beta subunit-like PLP-de 
   4::434  4.4e-70 30.7% 0050641 00506411 1/1   ophan synthase beta subunit-like PLP-de 
  64::427  8.7e-61 30.3% 0050156 00501561 1/1   ophan synthase beta subunit-like PLP-de 
  39::441    2e-60 28.6% 0039474 00394741 1/1   ophan synthase beta subunit-like PLP-de 
  68::437  4.5e-60 30.2% 0037348 00373481 1/1   ophan synthase beta subunit-like PLP-de 
  55::433  9.2e-60 29.8% 0050081 00500811 1/1   ophan synthase beta subunit-like PLP-de 
  68::436  1.1e-57 27.8% 0043354 00433541 1/1   ophan synthase beta subunit-like PLP-de 
  76::438  1.7e-56 29.5% 0048698 00486981 1/1   ophan synthase beta subunit-like PLP-de 
  73::435  1.6e-55 31.2% 0048837 00488371 1/1   ophan synthase beta subunit-like PLP-de 
   2::438  3.3e-53 24.8% 0036788 00367881 1/1   ophan synthase beta subunit-like PLP-de 
  74::432  2.2e-52 30.0% 0051972 00519721 1/1   ophan synthase beta subunit-like PLP-de 
  73::429  3.7e-51 28.8% 0041688 00416881 1/1   ophan synthase beta subunit-like PLP-de 
  71::431  5.2e-51 30.5% 0051225 00512251 1/1   ophan synthase beta subunit-like PLP-de 
  64::439  2.7e-50 27.3% 0043948 00439481 1/1   ophan synthase beta subunit-like PLP-de 
  70::422  3.8e-49 29.5% 0037494 00374941 1/1   ophan synthase beta subunit-like PLP-de 
  74::432  6.8e-48 28.6% 0050152 00501521 1/1   ophan synthase beta subunit-like PLP-de 
  70::445  1.8e-43 27.2% 0051522 00515221 1/1   ophan synthase beta subunit-like PLP-de 
  60::437  5.8e-37 27.4% 0039302 00393021 1/1   ophan synthase beta subunit-like PLP-de 
  62::430  1.8e-31 25.2% 0050075 00500751 1/1   ophan synthase beta subunit-like PLP-de 
  54::428  5.2e-26 23.7% 0050122 00501221 1/1   ophan synthase beta subunit-like PLP-de 
   1::461


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTEQAPHRLYLREDQIPTQWYNLRADMPEKPEPIRLPNGQVAAPEDLAPVFCDELVRQELDDDTAYVDIP
00429041   1/1  ---------------------------lpdepglfgefggllvpellllalle..leeaylsllrdiefl
00500981   1/1  ------------------------------------glfgplggryvpelllpallelelallryldllp
00506411   1/1  ---llllllllllllllldeeelpllllnllldllllllpglelaldelllfgelggllvpellllalee
00501561   1/1  ---------------------------------------------------------------ltlldil
00394741   1/1  --------------------------------------llgelggllvpelllpallelelallrlldil
00373481   1/1  -------------------------------------------------------------------lve
00500811   1/1  ------------------------------------------------------lalevllrfldllpil
00433541   1/1  -------------------------------------------------------------------lle
00486981   1/1  ----------------------------------------------------------------------
00488371   1/1  ----------------------------------------------------------------------
00367881   1/1  -trgealllllslellpesllnllltlltlllllkclecgvsfspalllglapdgGlyvpetllpaldel
00519721   1/1  ----------------------------------------------------------------------
00416881   1/1  ----------------------------------------------------------------------
00512251   1/1  ----------------------------------------------------------------------
00439481   1/1  ---------------------------------------------------------------ldalnll
00374941   1/1  ---------------------------------------------------------------------l
00501521   1/1  ----------------------------------------------------------------------
00515221   1/1  ---------------------------------------------------------------------l
00393021   1/1  -----------------------------------------------------------llldlafvlea
00500751   1/1  -------------------------------------------------------------lllelldil
00501221   1/1  -----------------------------------------------------eilslfiydeilpvelk


                         -         -         *         -         -         -         -:140
query           EPVLEMYRIYRPSPLCRAYNLEKALGTPAKIYYKFEGNNTSGSHKLNSAIAQAYYAKAQDLDGITTETGA
00429041   1/1  eelldllvslvgrpTPLiraerlsealg..akiylKrEdlnptgshKirgalgqillakeegkkrlvaet
00500981   1/1  fdielaalrillligpTPLvrlprlsealg.gaeiylKrEdlnptgSfKdRgalnlillaleegkkrlvv
00506411   1/1  leeaylsllrylefipeaadrildligpTPLvrlprlse.lgv..riylKlEdlnpltgSfKdRgalnli
00501561   1/1  ealdrillligpTPlvrlprlsellgv..riylKlEdlnptgSfKdRgalnlillae..ggktvveass.
00394741   1/1  eaaarlldligpTPlvrlprlsellgvgaeiylKlEdlnptgSfKdrgalnlillaleegklkpgrtvve
00373481   1/1  lilllillligpTPlvrlnrlsealglgaeiylKrEdlnptgSfgGnKdRkalylillaeaegadtlita
00500811   1/1  ealdrillligpTPlvrlpelrlsealga..niylKlEdlnptgSfKdrgalnlillaleegkltvveat
00433541   1/1  lllllvtlligpTPLvrlprlsealglgaeiylKrEdlnlgnptgsnKdRkllyllllalaegkdtliti
00486981   1/1  -----lkdligpTPlvrlprlsellgv..niylKlEdlnptgSfKdrgalnlillaleegklgvveats.
00488371   1/1  --lerildligpTPlvrlprlsellg..aniylKlEdlnptgSfKdrgalylillaeeegklgvveats.
00367881   1/1  elaylkalsypelalellslfig.leryaellddilaaadritdvigpTPLvrlerlsellgglaniylK
00519721   1/1  ---drildlignTPlvrlprlsellgv..riylKlEdlnptgSfKdrgalnlillaleegklkpgrtvve
00416881   1/1  --ydrillligpTPLvrlprl......gaeiylKlEdlnptgSfKdrgalnlillaleegllkpgvveas
00512251   1/1  kaadrildlignTPlvrlprlse....gariylKlEdlnptgSfKdrgalnlillaleegllkpgrtvve
00439481   1/1  lldlllileaadrlldligpTPlvrlprlsellgv..eiylKlEdlnptgSfKdRgalnlillaleegkg
00374941   1/1  laadrilllignTPLvrlsrl.....lgaeiylKlEdlnptgSfKdrgalnlillaleegklkpgrtvve
00501521   1/1  ---drilllignTPlvrlprlsellgv..riylKlEdlnptgSfKdRgalnlillaleegllkpglkrtv
00515221   1/1  eaadrildlignTPlvrlprlsellgv..eiylKlEslnptgSfKdRgalnlillaleegllkpglltvv
00393021   1/1  adrlldlig..pTPlvrlprlsellg..aeiylKrEdlnplltgsfKdRgalnlillaeaegkkggivie
00500751   1/1  aaaerildlignTPlvrlnrlsellga..eiylKlEslnptgSfKdRgalnaillaleegkgrtvveass
00501221   1/1  elivsay..igntPLvrlgr.........nlylkeefhnptgSfKdrgalllislleelgkkkgitivea


                         +         -         -         -         -         *         -:210
query           GQWGTALAEASAHFGLNLDVFMVKCSYEQKPFRRNIMETFDAHVTPSPSDTTEIGRKMLAEHPDSSGSLG
00429041   1/1  gaGnhgvalAaaAallglkcvivmpetdvarkklkvalmkllgAeVvlvpsgfdelldaalelaedwvgs
00500981   1/1  easaGNhgialAaaAallGlkcvivmpetdleaslekvallralGAevvlvgsg...............s
00506411   1/1  llaleegkkgrtvveasaGnhGialAlaAallGlkavivmpe...taspekvallralGAevvlvgg...
00501561   1/1  GnhgialAlaAallglkavivm...petaslekvallralGAevvlvg..................gtld
00394741   1/1  assGNhGialAlaAallglkavivmpet...aspekvallralGaevvlvggdsg.............tg
00373481   1/1  tgaqGnhgialAaaAallGlkcvivmpettslekvdedvlrqlgnvlllrllGAevvlvps.........
00500811   1/1  s.GNtGialAlaaallglkavivm...pegtvspekvallralGaevvlvg..................g
00433541   1/1  gasaGNhgvalAaaAallGlkcvivmpeivdlledvkrplgnvlllrllGaevilvps............
00486981   1/1  GnhgialAlaAallglkavivm...pedvsrekvallralGAevvlvggdldd.................
00488371   1/1  GnhgialAlaAallglkavivm...pedvslekvallralGaevvlvggdldd.................
00367881   1/1  lEflnptgSfKdrgalnlillaeylglkelgkktvvaats.GNtGaAlaaaaallgikvvivm...Pegk
00519721   1/1  assGntGialAlaaallglkavivm...pettslekvallralGaevvlvgg................sg
00416881   1/1  sGnhGialAlaAallglkavivm...pegaspekvallralGaevvlvggd................gtl
00512251   1/1  assGntGialAlaAallglkavivmpet...aslekvallralGaevvlvgg................sg
00439481   1/1  rtvveassGNhgialAlaAallglkavivm...petasaekvallralGAevvlvg..............
00374941   1/1  assGnhgialAlaAallglkavivm...pettslekvallralGaevvlvgg................sg
00501521   1/1  veassGnhgialAlaAallglkavivm...petaslekvallralGAevvlvgglddldd..........
00515221   1/1  eassGNtGialAlaAallglkavivm...pettslekvallralGaevvlvgg.................
00393021   1/1  asaGNhgialAlaAallglkavivmpdtasqe..gkvallralGaevvlvgggfd.......tlkdaeae
00500751   1/1  GNhGialAlaAallglkavivmPet...tslekvaalralGAevvlvg..................ggyd
00501221   1/1  TsGNtGaAvalafaalagikvvilvP..egkvspeklaqmralganvhlvave................g


                         -         -         -         +         -         -         -:280
query           TAISEAVERALNIPGNKGRYTLGSVLNQVVLHQSVIGLESYAAFEELGEYPDVVIGCAGGGSNLGGLIAP
00429041   1/1  lgitiyli..........ggayllhpfpnpvlagqstiglEileqllellgrlpDavvacvGgGgnaaGi
00500981   1/1  gtlddaiaealelaeengg.dtyyilgtlvnpfdnpanviagqgtiglEileqlggllgllpdavvvpvG
00506411   1/1  .............ggtlddaiaearelaee....egayyvgqfdnpanviagqgtiglEileqlgglgll
00501561   1/1  davaealelaee...pgavyvnpfdnplvilgqgtiglEileqlgglgllpdavvvpvGgGGliaGvalg
00394741   1/1  slddavalarelaeenp...gayyvnpfdnpanvlagqgtialEileql...gglpdavvvpvGgGGtia
00373481   1/1  .....gfddlldaaielarellaelggt..vyvipfgnsanplailgqatialEileqllelggkpdavv
00500811   1/1  tfddaialakelaee....pglvlvnpfnpavilgqgtiglEileql...gglpdavvvpvGggGliaGv
00433541   1/1  ..gfditlkealneaarllrelgektyvilgggsnhplgllgyvtlaleilqqlealgllpdavvvpvGt
00486981   1/1  .aveealelaeenp...gayyinpfdnplviagqgtiglEileql...gglpdavvvpvGgGgliaGvaa
00488371   1/1  .aveealelaaenp...gayyinpfdnplvilgqgtiglEileql...ggkpdavvvpvGgGgliaGvaa
00367881   1/1  vspekvaqmralGaevvlvg..................gtfddaqalakelaaeng....lvlvnpfnpn
00519721   1/1  tlddaiaealelaee....egavlvgqfdnpanviagqgtiglEileql...gglpdavvvpvGgGGlia
00416881   1/1  ddavalarelaee..pgavyvnqfdnpanviagqgtiglEileql...gglpdavvvpvGgGGliaGvar
00512251   1/1  tlddaialarelaeen..lpgayllgqfdnpanviagqgtiglEileql...gglpdavvvpvGgGGlia
00439481   1/1  ....gtlddavaearelaee....pgavyvnpfdnplviagqgtialEileqlgg....pdavvvpvGgG
00374941   1/1  tlddavalalelaeen..lpgayyvgqfdnpanviagqgtialEileql...gglpdavvvpvGgGGlia
00501521   1/1  ........avalarelaee...pgaylvnqfdnpanviagqgtialEileql...gglpdavvvpvGgGG
00515221   1/1  ...ggdlddavelarelaeelpgafyvnqfdnpanviagqgttglEileql...ggkpdavvvpvGgGGl
00393021   1/1  alarelaeegglayvip.......qddnppnviagqgtialEileql...ggkpdavvvpvGgGgtiaGl
00500751   1/1  dalalarelaee....eglvlvnpfdnpnviagqgtiglEileqlgg....pdavvvpvGgGGliaGval
00501221   1/1  nfddaqalvkelaadlglvlllnlqsansinparlagqktyafeileqlgkaggapdvvvvPvGngGnil


                         -         *         -         -         -         -         +:350
query           FMRDKIKGVRPDTRFVAVEPASCPSLTRGRYAYDFADTGRTCPLAKMYTLGNGFLPSPDHAGGLRYHGMS
00429041   1/1  aagfkel......pdvrligvepagaglltgglaasldlgdtgvlhglksyllqgeggtiapaisiadGl
00500981   1/1  gGgtiaGialglke......npdvkvigvepagapvltgslaagllvglpgvlgglgpl.llqgigggfi
00506411   1/1  pdavvapvGgGGliaGiarglkel.....dpdvkiigvepagsplltg..................adgi
00501561   1/1  lkel.....npdvkvigvepegspvllrsllagelvll...............lepvptiadglgvgrvg
00394741   1/1  Gvalglkel.....gpdvkvigvepegspllllslea....................gqipvptiadglg
00373481   1/1  vpvGtGgtaaGlalglkel.....gpdvkvigveaagsglltg.......................gqiv
00500811   1/1  alalkellllgligpdvkligvepegadvltrslkagep......................ptiadglgv
00433541   1/1  GgtaaGlalgfkel.....gpgvrvigveaagsglltleqvasladgtagllgggltfllqd........
00486981   1/1  glkeln....lpdvkiigvepegspllaaslkagkpvvlkg................vgtiadglgvgrv
00488371   1/1  gl.....kelnlpdvkiigvepegspvllrsllagepvpleeve................tiadglgvgr
00367881   1/1  riagqgtiafEileql...ggglpdavvvpvGggGliaGialalkellpiglldpdvriigveaegandl
00519721   1/1  Gvalalke.....lnpdvkiigvepegspll...................................tlad
00416881   1/1  glkell....gpgvkvigvepegspvltgslaagti............................adgigv
00512251   1/1  Gvarylkel....gnpdvkiigvepegspvlllslea...................geivplptiadglg
00439481   1/1  GtiaGvarglkel.....gpdvkvigvepegspvlygsllagel................vqgigagtia
00374941   1/1  Gvalglkell.....pdklvrvigvepegsaslllsle...................agqivplptiadg
00501521   1/1  liaGvarylkeln.....pdvkiigvepegspvllgslaag.........................tiad
00515221   1/1  iaGvarylkel.....npdvkiigvepegspvlagslaag.........................tiadg
00393021   1/1  alglkel.....npdvkvigvepagsaslllslvaglivt.........................iadgi
00500751   1/1  alkel.....npdvkiigvepegaal...................laasllagkivtlpevgtiadglav
00501221   1/1  giylalkegl.....pipkliavenen.dplar......flktgeyvpre..........vveTiapald


                         -         -         -         -         *         -         -:420
query           PIVSKLKHDGYLDAVAVKQTDVFAAAVEFARLETILPAPESAHAIFQAVEEAKRCAETGEEKTILFGLTG
00429041   1/1  dypgvgpelallldegraeyvavsdeealeafrllarteGiipepesahalaaalklakkl..lgkgktv
00500981   1/1  ppdtiadglavpgvgplalellrdlvdevvavsdeealeairllartegilvepssaaalaallklake.
00506411   1/1  gvgfvpp..................llddlvdevvtvsdeealeaarllartegilvepssaaalaaalk
00501561   1/1  plalallrelvdevvtvsdeealaairllarlegilvepssaaalaaalklake.....kgktvvvilsG
00394741   1/1  vgrvgpl...llrelvdevvtvsdeealeairllartegilvepssaaalaallklake...lgkgktvv
00373481   1/1  elasisagldgigvgpeplvlldsyvdeyvgvtdeealeaarllareegillepsYsgaalaallklake
00500811   1/1  grvgnlerllallrelvdevvtvsdeealaairllareegilvepssaaalaaalklaee.gelgkgktv
00433541   1/1  .agldydyvgpgyg............vtdeealeairllartegillepvYsakalagllklake.gelg
00486981   1/1  gpltflllrelvdevvtvsdeealeairllarlegilvepssaaalaallklllagelgkglgldedktv
00488371   1/1  vgpltfellrelvdevvtvsdeealeairllarlegilvepssaaalaallklledellllagelgkgkt
00367881   1/1  lhsflaggdydvqle..............evptiadgldigrpgnleralfllrelvdevvtvsdeeila
00519721   1/1  glgvgrvpllllrelvdevvtvsdeealaairllareegilvgpssaaalaaalklaeel....egktvv
00416881   1/1  grlpllllrelvdevvtvsdeealeaarllartegilvepssaaalaaalklale...lgegktvvvils
00512251   1/1  vgrvg...lellrelvdevvtvsdeealaaarllareegilvepssaaalaaalklakelgl..egktvv
00439481   1/1  dgldvgrvgplalallrelvdevvtvsdeealaairllarlegilvepssaaalaaalklakeg..llkg
00374941   1/1  lgvgrvg...lellrelvdevvtvsdeealeaarllareegilvepssaaalaaalklakeg..llkgkt
00501521   1/1  glgvgrvple...llrelvdevvtvsdeealaaarllareegilvepssaaalaaalklake...lgegk
00515221   1/1  lgvgrvple...llrelvdevvtvsdeealaaarllareegilvgpssaaalaaalklakelel..kgkt
00393021   1/1  gvgfvplvllrslvdevvtvsdeealeairllareegilvepvssaaalaallklakele...kgktvvv
00500751   1/1  pgvgfltfillrelvdevvtvsdeealaamrllaeeegilvepsgaaalaallklakelkgkkvvvvllg
00501221   1/1  igipsnferllldllgsdglrlvdevvtvsdeeilaair.laeregilvepssAaalaallklae.....


                         -         -         +         -         -         -         -:490
query           TGYFDMKAYDAYNRGEMSDHVPTDEELEAGFASIPHIEGVQ-----------------------------
00429041   1/1  vvvlsGrGdkdld---------------------------------------------------------
00500981   1/1  ..lgkgktvvvils--------------------------------------------------------
00506411   1/1  laeelgl..egktv--------------------------------------------------------
00501561   1/1  gglkyls---------------------------------------------------------------
00394741   1/1  viltggglkylstvlvilrll-------------------------------------------------
00373481   1/1  .gelgkgktvvvilsGg-----------------------------------------------------
00500811   1/1  vvlltggglkdld---------------------------------------------------------
00433541   1/1  kgstvvvilsG.Glkd------------------------------------------------------
00486981   1/1  vviltg.Gryldllllae----------------------------------------------------
00488371   1/1  vvviltg.Gryldll-------------------------------------------------------
00367881   1/1  airllar.egilvepssA----------------------------------------------------
00519721   1/1  viltggglkyls----------------------------------------------------------
00416881   1/1  ggglkylst-------------------------------------------------------------
00512251   1/1  vilsggglkyl-----------------------------------------------------------
00439481   1/1  ktvvvilsggglkylstvl---------------------------------------------------
00374941   1/1  vv--------------------------------------------------------------------
00501521   1/1  tvvvilsggglk----------------------------------------------------------
00515221   1/1  vvvilsggglkylstvlfllwllel---------------------------------------------
00393021   1/1  ilsG.Gnkdlpdlgery-----------------------------------------------------
00500751   1/1  gngdryllkl------------------------------------------------------------
00501221   1/1  .pgetvVv--------------------------------------------------------------